SPRY2 Antibody (10M8H1)

Novus Biologicals | Catalog # NBP3-33538

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 10M8H1
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 216-315 of human SPRY2 (O43597).

Sequence:
GTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SPRY2 Antibody (10M8H1)

SPRY2 Antibody (10M8H1)

Immunohistochemistry: SPRY2 Antibody (10M8H1) [NBP3-33538] -

Immunohistochemistry: SPRY2 Antibody (10M8H1) [NBP3-33538] - Immunohistochemistry analysis of paraffin-embedded Human appendix using SPRY2 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SPRY2 Antibody (10M8H1)

Western Blot: SPRY2 Antibody (10M8H1) [NBP3-33538] -

Western Blot: SPRY2 Antibody (10M8H1) [NBP3-33538] - Western blot analysis of lysates from C6 cells, using SPRY2 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
SPRY2 Antibody (10M8H1)

Immunohistochemistry: SPRY2 Antibody (10M8H1) [NBP3-33538] -

Immunohistochemistry: SPRY2 Antibody (10M8H1) [NBP3-33538] - Immunohistochemistry analysis of paraffin-embedded Rat pancreas using SPRY2 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for SPRY2 Antibody (10M8H1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SPRY2

Sprouty 2 encodes a protein belonging to the sprouty family. The encoded protein contains a carboxyl-terminal cysteine-rich domain essential for the inhibitory activity on receptor tyrosine kinase signaling proteins and is required for growth factor stimulated translocation of the protein to membrane ruffles. In primary dermal endothelial cells this gene is transiently upregulated in response to fibroblast growth factor two. This protein is indirectly involved in the non-cell autonomous inhibitory effect on fibroblast growth factor two signaling. The protein interacts with Cas-Br-M (murine) ectropic retroviral transforming sequence, and can function as a bimodal regulator of epidermal growth factor receptor/mitogen-activated protein kinase signaling. This protein may play a role in alveoli branching during lung development as shown by a similar mouse protein.

Long Name

Sprouty Homolog 2

Alternate Names

sprouty 2

Gene Symbol

SPRY2

Additional SPRY2 Products

Product Documents for SPRY2 Antibody (10M8H1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPRY2 Antibody (10M8H1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for SPRY2 Antibody (10M8H1)

There are currently no reviews for this product. Be the first to review SPRY2 Antibody (10M8H1) and earn rewards!

Have you used SPRY2 Antibody (10M8H1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...