SPTLC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56477

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE

Reactivity Notes

Mouse 88%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SPTLC1 Antibody - BSA Free

Western Blot: SPTLC1 Antibody [NBP2-56477]

Western Blot: SPTLC1 Antibody [NBP2-56477]

Western Blot: SPTLC1 Antibody [NBP2-56477] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: SPTLC1 Antibody [NBP2-56477]

Immunocytochemistry/ Immunofluorescence: SPTLC1 Antibody [NBP2-56477]

Immunocytochemistry/Immunofluorescence: SPTLC1 Antibody [NBP2-56477] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
SPTLC1 Antibody Western Blot: SPTLC1 Antibody Antibody [NBP2-56477]

Western Blot: SPTLC1 Antibody Antibody [NBP2-56477]

Analysis using NBP2-56477 (A) shows similar pattern to independent antibody NBP1-81737 (B).

Applications for SPTLC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

1:100 - 1:250
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPTLC1

Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. The product of this gene is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified. (provided by RefSeq)

Long Name

Serine palmitoyltransferase 1

Alternate Names

LCB 1, LCB1, SPT 1, SPT1

Gene Symbol

SPTLC1

Additional SPTLC1 Products

Product Documents for SPTLC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPTLC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPTLC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPTLC1 Antibody - BSA Free and earn rewards!

Have you used SPTLC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...