SRP54 Antibody (1O3J1)

Novus Biologicals | Catalog # NBP3-33390

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1O3J1
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-504 of human SRP54 (P61011).

Sequence:
PGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SRP54 Antibody (1O3J1)

SRP54 Antibody (1O3J1)

Western Blot: SRP54 Antibody (1O3J1) [NBP3-33390] -

Western Blot: SRP54 Antibody (1O3J1) [NBP3-33390] - Western blot analysis of various lysates using SRP54 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
SRP54 Antibody (1O3J1)

Immunocytochemistry/ Immunofluorescence: SRP54 Antibody (1O3J1) [NBP3-33390] -

Immunocytochemistry/ Immunofluorescence: SRP54 Antibody (1O3J1) [NBP3-33390] - Immunofluorescence analysis of C6 cells using SRP54 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SRP54 Antibody (1O3J1)

Immunocytochemistry/ Immunofluorescence: SRP54 Antibody (1O3J1) [NBP3-33390] -

Immunocytochemistry/ Immunofluorescence: SRP54 Antibody (1O3J1) [NBP3-33390] - Immunofluorescence analysis of NIH-3T3 cells using SRP54 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SRP54 Antibody (1O3J1)

Immunocytochemistry/ Immunofluorescence: SRP54 Antibody (1O3J1) [NBP3-33390] -

Immunocytochemistry/ Immunofluorescence: SRP54 Antibody (1O3J1) [NBP3-33390] - Immunofluorescence analysis of U-2 OS cells using SRP54 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for SRP54 Antibody (1O3J1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SRP54

SRP54 binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein)

Alternate Names

signal recognition particle 54 kDa protein, signal recognition particle 54kD, signal recognition particle 54kDa

Gene Symbol

SRP54

Additional SRP54 Products

Product Documents for SRP54 Antibody (1O3J1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SRP54 Antibody (1O3J1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SRP54 Antibody (1O3J1)

There are currently no reviews for this product. Be the first to review SRP54 Antibody (1O3J1) and earn rewards!

Have you used SRP54 Antibody (1O3J1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...