STRAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56502

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IHCVRFSPDGELYASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for STRAP Antibody - BSA Free

Western Blot: STRAP Antibody [NBP2-56502]

Western Blot: STRAP Antibody [NBP2-56502]

Western Blot: STRAP Antibody [NBP2-56502] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: STRAP Antibody [NBP2-56502]

Immunocytochemistry/ Immunofluorescence: STRAP Antibody [NBP2-56502]

Immunocytochemistry/Immunofluorescence: STRAP Antibody [NBP2-56502] - Staining of human cell line U-2 OS shows localization to cytosol.
Western Blot: STRAP Antibody [NBP2-56502]

Western Blot: STRAP Antibody [NBP2-56502]

Western Blot: STRAP Antibody [NBP2-56502] - Analysis using Anti-STRAP antibody NBP2-56502 (A) shows similar pattern to independent antibody NBP2-38757 (B).

Applications for STRAP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STRAP

The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex

Alternate Names

MAP activator with WD repeats, MAWDpt-wd, serine/threonine kinase receptor associated protein, serine-threonine kinase receptor-associated protein, UNR-interacting protein, UNRIPPT-WD, WD-40 repeat protein PT-WD

Gene Symbol

STRAP

Additional STRAP Products

Product Documents for STRAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for STRAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STRAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STRAP Antibody - BSA Free and earn rewards!

Have you used STRAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STRAP Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am looking to buy an antibody for STRAP (serine-threonine receptor associated protein) and was wondering if you had published references related to the use of your STRAP antibodies. My application would be for Western blot.

    A: Unfortunately, we do not have any published references related to the use of our STRAP antibodies yet. The antibodies were tested and validated and the images published on our website are in house images. If you would like me to help you choose an antibody that would be the best choice for your purposes please let me know what species you are working with. I also wanted to mention our 100% Novus Guarantee to you. We guarantee that the antibody you will use will work in species and application we have validated it in. If you experience any troubles, we will be happy to troubleshoot with you. However, should we fail to resolve your problems we will refund your purchase or replace the antibody with a more appropriate substitute.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...