SUB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38376

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human SUB1 (NP_006704.3).

Sequence:
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SUB1 Antibody - BSA Free

SUB1 Antibody

Western Blot: SUB1 Antibody [NBP3-38376] -

Western Blot: SUB1 Antibody [NBP3-38376] - Western blot analysis of various lysates using SUB1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
SUB1 Antibody

Immunocytochemistry/ Immunofluorescence: SUB1 Antibody [NBP3-38376] -

Immunocytochemistry/ Immunofluorescence: SUB1 Antibody [NBP3-38376] - Immunofluorescence analysis of A549 cells using SUB1 Rabbit pAb.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution.
SUB1 Antibody

Immunoprecipitation: SUB1 Antibody [NBP3-38376] -

Immunoprecipitation: SUB1 Antibody [NBP3-38376] - Immunoprecipitation analysis of 150 ug extracts of HL60 cells using 3 ug SUB1 antibody. Western blot was performed from the immunoprecipitate using SUB1 antibody at a dilution of 1:500.

Applications for SUB1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SUB1

PC4 is a multifunctional transcriptional coactivator that plays an important role in transcription, repair, and replication. PC4 interacts with general transcription factors, DNA repair factors, and mRNA processing factors to influence transcription initiation, coactivation, polyadenylation, transcription termination, and transcriptional repression. PC4 has been demonstrated to be a DNA binding protein and a bona fide component of chromatin with chromatin-compacting ability. Alternate names for PC4 include activated RNA polymerase II transcriptional coactivator p15, SUB1 homolog, positive cofactor 4, p14, SUB1, RPO2TC1, and MGC102747.

Alternate Names

activated RNA polymerase II transcription cofactor 4, activated RNA polymerase II transcriptional coactivator p15, MGC102747, p15, PC4p14P15, Positive cofactor 4, RPO2TC1, SUB1 homolog, SUB1 homolog (S. cerevisiae)

Gene Symbol

SUB1

Additional SUB1 Products

Product Documents for SUB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SUB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SUB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SUB1 Antibody - BSA Free and earn rewards!

Have you used SUB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...