SUMO2/3 Antibody (6R8G7)

Novus Biologicals | Catalog # NBP3-16540

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6R8G7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-95 of human SUMO2/3 (P61956). MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SUMO2/3 Antibody (6R8G7)

Western Blot: SUMO2/3 Antibody (6R8G7) [NBP3-16540]

Western Blot: SUMO2/3 Antibody (6R8G7) [NBP3-16540]

Western Blot: SUMO2/3 Antibody (6R8G7) [NBP3-16540] - Western blot analysis of extracts of various cell lines, using SUMO2/3 Rabbit mAb (NBP3-16540) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: SUMO2/3 Antibody (6R8G7) [NBP3-16540]

Immunocytochemistry/ Immunofluorescence: SUMO2/3 Antibody (6R8G7) [NBP3-16540]

Immunocytochemistry/Immunofluorescence: SUMO2/3 Antibody (6R8G7) [NBP3-16540] - Immunofluorescence analysis of U-2 OS cells using SUMO2/3 Rabbit mAb (NBP3-16540) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: SUMO2/3 Antibody (6R8G7) [NBP3-16540]

Immunohistochemistry-Paraffin: SUMO2/3 Antibody (6R8G7) [NBP3-16540]

Immunohistochemistry-Paraffin: SUMO2/3 Antibody (6R8G7) [NBP3-16540] - Immunohistochemistry of paraffin-embedded human esophageal using SUMO2/3 Rabbit mAb (NBP3-16540) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SUMO2/3 Antibody (6R8G7) [NBP3-16540]

Immunohistochemistry-Paraffin: SUMO2/3 Antibody (6R8G7) [NBP3-16540]

Immunohistochemistry-Paraffin: SUMO2/3 Antibody (6R8G7) [NBP3-16540] - Immunohistochemistry of paraffin-embedded rat ovary using SUMO2/3 Rabbit mAb (NBP3-16540) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
SUMO2/3 Antibody (6R8G7)

Immunohistochemistry: SUMO2/3 Antibody (6R8G7) [NBP3-16540] -

Immunohistochemistry: SUMO2/3 Antibody (6R8G7) [NBP3-16540] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using SUMO2/3 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SUMO2/3 Antibody (6R8G7)

Immunohistochemistry: SUMO2/3 Antibody (6R8G7) [NBP3-16540] -

Immunohistochemistry: SUMO2/3 Antibody (6R8G7) [NBP3-16540] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using SUMO2/3 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SUMO2/3 Antibody (6R8G7)

Immunohistochemistry: SUMO2/3 Antibody (6R8G7) [NBP3-16540] -

Immunohistochemistry: SUMO2/3 Antibody (6R8G7) [NBP3-16540] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using SUMO2/3 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SUMO2/3 Antibody (6R8G7)

Immunohistochemistry: SUMO2/3 Antibody (6R8G7) [NBP3-16540] -

Immunohistochemistry: SUMO2/3 Antibody (6R8G7) [NBP3-16540] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin using SUMO2/3 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for SUMO2/3 Antibody (6R8G7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SUMO2/3

Small Ubiquitin-like Modifiers (SUMOs) are a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed SUMOylation. There are four known SUMOs (SUMO1-4). All SUMO proteins share a conserved Ubiquitin domain and a C-terminal diglycine cleavage/attachment site. Following cleavage of a C-terminal prosegment, the C-terminal glycine residue of SUMO is enzymatically attached to a lysine residue on a target protein. In humans, SUMO is conjugated to a variety of molecules in the presence of the SAE1/UBA2 SUMO-activating (E1) enzyme and the UBE2I/Ubc9 SUMO-conjugating (E2) enzyme. In yeast, the SUMO-activating (E1) enzyme is Aos1/Uba2p. SUMOylation can occur without the requirement of a specific SUMO ligase (E3), where SUMO is transferred directly from UBE2I/Ubc9 to specific substrates. Unlike SUMO1, which is usually conjugated to proteins as a monomer, SUMO2 and SUMO3 are known to form high molecular weight polymers on proteins. SUMO precursor processing and deconjugation are catalyzed by a family of cysteine proteases known as SUMO-specific proteases (SENPs) and DeSUMOylating Isopeptidase 1.

Long Name

Small Ubiquitin-like Modifier 2, & 3

Alternate Names

HSMT3, small ubiquitin-like modifier 2, SMT3A, SMT3B, SMT3H2, SUMO2, SUMO3

Gene Symbol

SUMO2

Additional SUMO2/3 Products

Product Documents for SUMO2/3 Antibody (6R8G7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SUMO2/3 Antibody (6R8G7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SUMO2/3 Antibody (6R8G7)

There are currently no reviews for this product. Be the first to review SUMO2/3 Antibody (6R8G7) and earn rewards!

Have you used SUMO2/3 Antibody (6R8G7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...