SWAP70 Antibody (3H8) - Azide and BSA Free

Novus Biologicals | Catalog # H00023075-M09

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3H8

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SWAP70 (NP_055870, 378 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA

Reactivity Notes

Human, mouse & rat. Other species have not been tested.

Specificity

SWAP70 - SWAP-70 protein

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for SWAP70 Antibody (3H8) - Azide and BSA Free

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in human spleen.
Immunohistochemistry-Paraffin: SWAP70 Antibody (3H8) [H00023075-M09]

Immunohistochemistry-Paraffin: SWAP70 Antibody (3H8) [H00023075-M09]

Immunohistochemistry-Paraffin: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of monoclonal antibody to SWAP70 on formalin-fixed paraffin-embedded human spleen. Antibody concentration 3 ug/ml
Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in PC-12 (Cat # L012V1).
Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in Raw 264.7.
Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in NIH/3T3 (Cat # L018V1).
Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09]

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in transfected 293T cell line by SWAP70 monoclonal antibody (M09), clone 3H8. Lane 1: SWAP70 transfected lysatE (69 KDa). Lane 2: Non-transfected lysate.
ELISA: SWAP70 Antibody (3H8) [H00023075-M09]

ELISA: SWAP70 Antibody (3H8) [H00023075-M09]

ELISA: SWAP70 Antibody (3H8) [H00023075-M09] - Detection limit for recombinant GST tagged SWAP70 is approximately 0.1ng/ml as a capture antibody.

Applications for SWAP70 Antibody (3H8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SWAP70

Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. It also mediates signaling of membrane ruffling. Regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion

Long Name

Switch-associated Protein 70 kDa

Alternate Names

KIAA0640SWAP-70FLJ39540, SWAP switching B-cell complex 70kDa subunit, switch-associated protein 70

Entrez Gene IDs

23075 (Human)

Gene Symbol

SWAP70

OMIM

604762 (Human)

Additional SWAP70 Products

Product Documents for SWAP70 Antibody (3H8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SWAP70 Antibody (3H8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for SWAP70 Antibody (3H8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SWAP70 Antibody (3H8) - Azide and BSA Free and earn rewards!

Have you used SWAP70 Antibody (3H8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...