Synaptotagmin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34215

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Synaptotagmin 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Analysis in human cerebral cortex and pancreas tissues using NBP2-34215 antibody. Corresponding Synaptotagmin 1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human cerebellum, liver, pancreas and testis using Anti-Synaptotagmin 1 antibody NBP2-34215 (A) shows similar protein distribution across tissues to independent antibody NBP1-87362 (B).
Western Blot: Synaptotagmin 1 Antibody [NBP2-34215]

Western Blot: Synaptotagmin 1 Antibody [NBP2-34215]

Western Blot: Synaptotagmin 1 Antibody [NBP2-34215] - Analysis in control (vector only transfected HEK293T lysate) and SYT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human liver.
Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human testis.
Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human cerebral cortex using Anti-SYT1 antibody NBP2-34215.
Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215]

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human pancreas using Anti-SYT1 antibody NBP2-34215.

Applications for Synaptotagmin 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Synaptotagmin-1

Synaptotagmin is widely regarded as the primary calcium sensor for synaptic vesicle exocytosis (Fernandez-Chacon et al., 2001; Wang et al., 2003). Moreover recent studies indicate that the protein also plays a key role in endocytosis (Poskanzer et al., 2003). Synaptotagmin can be phosphorylated by multiple protein kinases and this may play a key role in modulation of synaptotagmin ability to influence both the exocytotic and endocytotic components of synaptic transmission (Hilfiker et al., 1999; Lee et al., 2004).

Alternate Names

P65, SVP65, Synaptotagmin1, SYT1

Gene Symbol

SYT1

UniProt

Additional Synaptotagmin-1 Products

Product Documents for Synaptotagmin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Synaptotagmin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Synaptotagmin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Synaptotagmin 1 Antibody - BSA Free and earn rewards!

Have you used Synaptotagmin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...