Syntenin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86979

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Syntenin 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%). Human reactivity reported in scientific literature (PMID: 24305713).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Syntenin 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Syntenin 1 Antibody [NBP1-86979]

Immunocytochemistry/ Immunofluorescence: Syntenin 1 Antibody [NBP1-86979]

Immunocytochemistry/Immunofluorescence: Syntenin 1 Antibody [NBP1-86979] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, nuclear membrane & cytosol.
Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979]

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979]

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979]

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979]

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979]

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979]

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979]

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979]

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979] - Staining of human placenta shows weak tcytoplasmic positivity in trophoblastic cells.
Syntenin 1 Antibody - BSA Free Western Blot: Syntenin 1 Antibody - BSA Free [NBP1-86979]

Western Blot: Syntenin 1 Antibody - BSA Free [NBP1-86979]

Analysis in human cell line SK-MEL-30 and human cell line MCF-7.

Applications for Syntenin 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 24305713). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Syntenin 1

Syntenin 1 is encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

MDA9, MDA-9, melanoma differentiation associated protein-9, Melanoma differentiation-associated protein 9, Pro-TGF-alpha cytoplasmic domain-interacting protein 18, Scaffold protein Pbp1, ST1, SYCLTACIP18, syndecan binding protein (syntenin), Syndecan-binding protein 1, syntenin-1

Gene Symbol

SDCBP

Additional Syntenin 1 Products

Product Documents for Syntenin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Syntenin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Syntenin 1 Antibody - BSA Free

Customer Reviews for Syntenin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Syntenin 1 Antibody - BSA Free and earn rewards!

Have you used Syntenin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies