Synuclein alpha/beta Antibody (9E9X5)

Novus Biologicals | Catalog # NBP3-33536

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 9E9X5
View all Synuclein alpha/beta Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Synuclein alpha/beta (P37840).

Sequence:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Synuclein alpha/beta Antibody (9E9X5)

Synuclein alpha/beta Antibody (9E9X5)

Western Blot: Synuclein alpha/beta Antibody (9E9X5) [NBP3-33536] -

Western Blot: Synuclein alpha/beta Antibody (9E9X5) [NBP3-33536] - Western blot analysis of lysates from U-87MG cells, using Synuclein alpha/beta Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 3min.
Synuclein alpha/beta Antibody (9E9X5)

Immunocytochemistry/ Immunofluorescence: Synuclein alpha/beta Antibody (9E9X5) [NBP3-33536] -

Immunocytochemistry/ Immunofluorescence: Synuclein alpha/beta Antibody (9E9X5) [NBP3-33536] - Immunofluorescence analysis of paraffin-embedded rat brain using Synuclein alpha/beta Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Synuclein alpha/beta Antibody (9E9X5)

Western Blot: Synuclein alpha/beta Antibody (9E9X5) [NBP3-33536] -

Western Blot: Synuclein alpha/beta Antibody (9E9X5) [NBP3-33536] - Western blot analysis of various lysates using Synuclein alpha/beta Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1min.

Applications for Synuclein alpha/beta Antibody (9E9X5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Synuclein alpha/beta

Alternate Names

beta-synuclein, I(2)-synuclein, I+/--synuclein, NACP, non A-beta component of AD amyloid, PARK1, PD1, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein

Gene Symbol

SNCA

Additional Synuclein alpha/beta Products

Product Documents for Synuclein alpha/beta Antibody (9E9X5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Synuclein alpha/beta Antibody (9E9X5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Synuclein alpha/beta Antibody (9E9X5)

There are currently no reviews for this product. Be the first to review Synuclein alpha/beta Antibody (9E9X5) and earn rewards!

Have you used Synuclein alpha/beta Antibody (9E9X5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies