TAF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82774

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TAF6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TAF6 Antibody - BSA Free

Western Blot: TAF6 Antibody [NBP1-82774]

Western Blot: TAF6 Antibody [NBP1-82774]

Western Blot: TAF6 Antibody [NBP1-82774] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry: TAF6 Antibody [NBP1-82774]

Immunohistochemistry: TAF6 Antibody [NBP1-82774]

Immunohistochemistry: TAF6 Antibody [NBP1-82774] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774]

Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774]

Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774]

Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774]

Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774]

Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774]

Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774] - Staining of human fallopian tube shows moderate nuclear positivity in a subset of glandular cells.
TAF6 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TAF6 Antibody - BSA Free [NBP1-82774]

Chromatin Immunoprecipitation-exo-Seq: TAF6 Antibody - BSA Free [NBP1-82774]

ChIP-Exo-Seq composite graph for Anti-TAF6 (NBP1-82774) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
TAF6 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: TAF6 Antibody [NBP1-82774]

Immunocytochemistry/ Immunofluorescence: TAF6 Antibody [NBP1-82774]

Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Applications for TAF6 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF6

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1, the largest subunit of TFIID. Four isoforms have been identified but complete transcripts have been determined for only three isoforms. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.

Alternate Names

DKFZp781E21155, MGC:8964, RNA polymerase II, E, 70/85kD, TAF(II)70, TAF(II)80, TAF2ERNA polymerase II TBP-associated factor subunit E, TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa, TAFII70TAFII-80, TAFII80TAFII-70, TAFII85, Transcription initiation factor TFIID 70 kDa subunit, Transcription initiation factor TFIID 80 kDa subunit, transcription initiation factor TFIID subunit 6

Gene Symbol

TAF6

Additional TAF6 Products

Product Documents for TAF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TAF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF6 Antibody - BSA Free and earn rewards!

Have you used TAF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies