TBK1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13416

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TBK1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: MLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TBK1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TBK1 Antibody [NBP2-13416]

Immunocytochemistry/ Immunofluorescence: TBK1 Antibody [NBP2-13416]

Immunocytochemistry/Immunofluorescence: TBK1 Antibody [NBP2-13416] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TBK1 Antibody [NBP2-13416]

Immunohistochemistry-Paraffin: TBK1 Antibody [NBP2-13416]

Immunohistochemistry-Paraffin: TBK1 Antibody [NBP2-13416] - Staining of human testis shows moderate cytoplasmic, membranous and nuclear positivity in cells in seminiferus ducts.
TBK1 Antibody - BSA Free Immunohistochemistry: TBK1 Antibody - BSA Free [NBP2-13416]

Immunohistochemistry: TBK1 Antibody - BSA Free [NBP2-13416]

Staining of human Cerebellum shows moderate nuclear and cytoplasmic positivity in Purkinje cells.
TBK1 Antibody - BSA Free Immunohistochemistry: TBK1 Antibody - BSA Free [NBP2-13416]

Immunohistochemistry: TBK1 Antibody - BSA Free [NBP2-13416]

Staining of human Duodenum shows moderate cytoplasmic positivity in glandular cells.
TBK1 Antibody - BSA Free Immunohistochemistry: TBK1 Antibody - BSA Free [NBP2-13416]

Immunohistochemistry: TBK1 Antibody - BSA Free [NBP2-13416]

Staining of human Tonsil shows moderate nuclear and cytoplasmic positivity in germinal and non-germinal center cells.
TBK1 Antibody - BSA Free Immunohistochemistry: TBK1 Antibody - BSA Free [NBP2-13416]

Immunohistochemistry: TBK1 Antibody - BSA Free [NBP2-13416]

Staining of human Testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Applications for TBK1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TBK1

NFkappaB-activating kinase (NAK) also known as TANK binding kinase-1 (TBK1) or tumor necrosis factor receptor associated factor 2-associated kinase (T2K) is a serine/threonine protein that belongs to the IkB kinase (IKK) family (1). Similar to IKK alpha and beta (2), NAK induces IkB degradation and NF-kB activity. NAK is activated by phorbol ester tumour promoters and growth factors, whereas catalytically inactive NAK specifically inhibits activation of NF-kB by protein kinase C-epsilon (PKCepsilon). NAK specifically phosphorylates IkB alpha on Serine 36 and NFkB subunit RelA (p65) on Serine 536 (3). NAK is also known to interact with TANK, TRAF-2 and TRIF (4).

Long Name

TANK Binding Kinase 1

Alternate Names

FTDALS4, NAK, NFKB-Activating Kinase

Gene Symbol

TBK1

Additional TBK1 Products

Product Documents for TBK1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TBK1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TBK1 Antibody - BSA Free

Customer Reviews for TBK1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TBK1 Antibody - BSA Free and earn rewards!

Have you used TBK1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TBK1 Antibody - BSA Free

Showing  1 - 5 of 6 FAQs Showing All

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

Showing  1 - 5 of 6 FAQs Showing All
View all FAQs for Antibodies