TBP like protein TLP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49671

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TBP like protein TLP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TBP like protein TLP Antibody [NBP2-49671]

Immunocytochemistry/ Immunofluorescence: TBP like protein TLP Antibody [NBP2-49671]

Immunocytochemistry/Immunofluorescence: TBP like protein TLP Antibody [NBP2-49671] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671]

Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671]

Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining in human testis and liver tissues using anti-TBPL1 antibody. Corresponding TBPL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671]

Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671]

Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671]

Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671]

Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining of human testis shows high expression.

Applications for TBP like protein TLP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TBP like protein TLP

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that serves the same function as TBP and substitutes for TBP at some promoters that are not recognized by TFIID. It is essential for spermiogenesis and believed to be important in expression of developmentally regulated genes.

Alternate Names

21 kDa TBP-like protein, STUD21-kDA TBP-like protein, TATA box binding protein-related factor 2, TATA box-binding protein-like protein 1, TATA box-binding protein-related factor 2, TBP-like 1, TBP-like factor, TBP-like protein 1, TBP-related factor 2, TBP-related protein, TLFMGC:8389, TLP21, TLPMGC:9620, TRF2Second TBP of unique DNA protein, TRP

Gene Symbol

TBPL1

Additional TBP like protein TLP Products

Product Documents for TBP like protein TLP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TBP like protein TLP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TBP like protein TLP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TBP like protein TLP Antibody - BSA Free and earn rewards!

Have you used TBP like protein TLP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...