TDP-43/TARDBP Antibody (4R5L7)
Novus Biologicals | Catalog # NBP3-15677
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation (ChIP)
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 4R5L7 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human TDP-43/TARDB (Q13148). GNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGG
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit TDP-43/TARDBP Antibody (4R5L7) (NBP3-15677) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for TDP-43/TARDBP Antibody (4R5L7)
Western Blot: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]
Western Blot: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Western blot analysis of extracts of various cell lines, using TDP-43/TARDBP antibody (NBP3-15677) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Immunohistochemistry of paraffin-embedded mouse brain using TDP-43/TARDBP Rabbit mAb (NBP3-15677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Immunohistochemistry of paraffin-embedded rat ovary using TDP-43/TARDBP Rabbit mAb (NBP3-15677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Immunohistochemistry of paraffin-embedded human esophageal using TDP-43/TARDBP Rabbit mAb (NBP3-15677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -
Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -
Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Confocal imaging of HeLa cells using TDP-43/TARDBP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -
Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunoprecipitation of TDP-43/TARDBP from 500 ug extracts of K-562 cells was performed using 2 ug of TDP-43/TARDBP Rabbit mAb. Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using TDP-43/TARDBP Rabbit mAb at a dilution of 1:500.Chromatin Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -
Chromatin Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Chromatin immunoprecipitation analysis of extracts of K562 cells, using TDP-43/TARDBP Rabbit mAb and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -
Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Confocal imaging of paraffin-embedded Mouse brain tissue using TDP-43/TARDBP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -
Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Mouse colon using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -
Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Human colon using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -
Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -
Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Rat liver using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Applications for TDP-43/TARDBP Antibody (4R5L7)
Application
Recommended Usage
Chromatin Immunoprecipitation (ChIP)
5μg antibody for 10μg-15μg of Chromatin
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:200 - 1:2000
Immunohistochemistry
1:200 - 1:2000
Immunohistochemistry-Paraffin
1:200 - 1:2000
Western Blot
1:1000 - 1:6000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: TDP-43/TARDBP
Long Name
TAR DNA-binding Protein 43
Alternate Names
ALS10, TARDBP, TDP43
Gene Symbol
TARDBP
Additional TDP-43/TARDBP Products
Product Documents for TDP-43/TARDBP Antibody (4R5L7)
Product Specific Notices for TDP-43/TARDBP Antibody (4R5L7)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for TDP-43/TARDBP Antibody (4R5L7)
There are currently no reviews for this product. Be the first to review TDP-43/TARDBP Antibody (4R5L7) and earn rewards!
Have you used TDP-43/TARDBP Antibody (4R5L7)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ChIP Protocol Video
- Chromatin Immunoprecipitation (ChIP) Protocol
- Chromatin Immunoprecipitation Protocol
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...