TDP-43/TARDBP Antibody (4R5L7)

Novus Biologicals | Catalog # NBP3-15677

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4R5L7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-400 of human TDP-43/TARDB (Q13148). GNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit TDP-43/TARDBP Antibody (4R5L7) (NBP3-15677) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for TDP-43/TARDBP Antibody (4R5L7)

Western Blot: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]

Western Blot: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]

Western Blot: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Western blot analysis of extracts of various cell lines, using TDP-43/TARDBP antibody (NBP3-15677) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Immunohistochemistry of paraffin-embedded mouse brain using TDP-43/TARDBP Rabbit mAb (NBP3-15677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Immunohistochemistry of paraffin-embedded rat ovary using TDP-43/TARDBP Rabbit mAb (NBP3-15677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677]

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Immunohistochemistry of paraffin-embedded human esophageal using TDP-43/TARDBP Rabbit mAb (NBP3-15677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
TDP-43/TARDBP Antibody (4R5L7)

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TDP-43/TARDBP Antibody (4R5L7)

Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -

Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Confocal imaging of HeLa cells using TDP-43/TARDBP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
TDP-43/TARDBP Antibody (4R5L7)

Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -

Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunoprecipitation of TDP-43/TARDBP from 500 ug extracts of K-562 cells was performed using 2 ug of TDP-43/TARDBP Rabbit mAb. Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using TDP-43/TARDBP Rabbit mAb at a dilution of 1:500.
TDP-43/TARDBP Antibody (4R5L7)

Chromatin Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -

Chromatin Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Chromatin immunoprecipitation analysis of extracts of K562 cells, using TDP-43/TARDBP Rabbit mAb and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
TDP-43/TARDBP Antibody (4R5L7)

Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -

Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Confocal imaging of paraffin-embedded Mouse brain tissue using TDP-43/TARDBP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
TDP-43/TARDBP Antibody (4R5L7)

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Mouse colon using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TDP-43/TARDBP Antibody (4R5L7)

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Human colon using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TDP-43/TARDBP Antibody (4R5L7)

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TDP-43/TARDBP Antibody (4R5L7)

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] -

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Rat liver using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for TDP-43/TARDBP Antibody (4R5L7)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

5μg antibody for 10μg-15μg of Chromatin

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:200 - 1:2000

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TDP-43/TARDBP

TARDBP, also known as TAR DNA binding protein, is a DNA and RNA-binding protein which regulates transcription and splicing. TARDBP is also involved in the regulation of CFTR splicing and promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. TARD-BP may also be involved in microRNA biogenesis, apoptosis and cell division. TARDBP can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat.

Long Name

TAR DNA-binding Protein 43

Alternate Names

ALS10, TARDBP, TDP43

Gene Symbol

TARDBP

Additional TDP-43/TARDBP Products

Product Documents for TDP-43/TARDBP Antibody (4R5L7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TDP-43/TARDBP Antibody (4R5L7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for TDP-43/TARDBP Antibody (4R5L7)

There are currently no reviews for this product. Be the first to review TDP-43/TARDBP Antibody (4R5L7) and earn rewards!

Have you used TDP-43/TARDBP Antibody (4R5L7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...