TGIF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55829

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ

Reactivity Notes

Mouse 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TGIF1 Antibody - BSA Free

Western Blot: TGIF1 Antibody [NBP2-55829]

Western Blot: TGIF1 Antibody [NBP2-55829]

Western Blot: TGIF1 Antibody [NBP2-55829] - Analysis in human cell lines A-549 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western Blot: TGIF1 Antibody [NBP2-55829]

Western Blot: TGIF1 Antibody [NBP2-55829]

Western Blot: TGIF1 Antibody [NBP2-55829] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: TGIF1 Antibody [NBP2-55829]

Immunocytochemistry/ Immunofluorescence: TGIF1 Antibody [NBP2-55829]

Immunocytochemistry/Immunofluorescence: TGIF1 Antibody [NBP2-55829] - Staining of human cell line A549 shows localization to nucleoplasm.
TGIF1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TGIF1 Antibody - BSA Free [NBP2-55829]

Chromatin Immunoprecipitation-exo-Seq: TGIF1 Antibody - BSA Free [NBP2-55829]

ChIP-Exo-Seq composite graph for Anti-TGIF1 (NBP2-55829) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TGIF1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TGIF1

Novel homeobox gene, denoted TGIF (interacting factor), belongs to an expanding TALE (three amino acid loop extension) superclass of atypical homeodomains. The TGIF homeodomain binds to a previously characterized retinoid X receptor (RXR) responsive element from the cellular retinol-binding protein II promoter (CRBPII-RXRE), which contains an unusual DNA target for a homeobox (1). In vitro studies have implicated TGIF as a transcriptional repressor and corepressor in retinoid and TGF-beta signaling pathways that regulate several important biological processes. Heterozygous nonsense and missense mutations of the human TGIF gene have been associated with holoprosencephaly, the most common congenital malformation of the forebrain (2). It has been reported that TGIF plays an unexpected role in the inhibition of Smad2 phosphorylation, which occurs by a mechanism independent of its association with Smad2. This inhibitory function of TGIF is executed in concert with c-Jun, which facilitates the interaction of TGIF with cPML, resulting in the nuclear sequestration of cPML and the disruption of the cPML-SARA complex (3).

Long Name

TGFB-induced Factor Homeobox 1

Alternate Names

HPE4

Gene Symbol

TGIF1

Additional TGIF1 Products

Product Documents for TGIF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TGIF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TGIF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TGIF1 Antibody - BSA Free and earn rewards!

Have you used TGIF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...