Mouse THSD1 (Thrombospondin type-1 domain-containing protein 1), also known as Transmembrane molecule with thrombospondin module (Tmtsp), is a 95 kDa, type I transmembrane protein. It is synthesized as a precursor that is 851 amino acids (aa) in length, and has a 24 aa signal sequence, a 388 aa extracellular region, a 21 aa transmembrane region, and a 418 aa cytoplasmic region. The extracellular region contains six potential N-linked glycosylation sites and the thrombospondin type-1 (TSP1) domain, which is implicated in cell adhesion and migration. Also present in the molecule are 9 PKC-phosphorylation sites, 3 Ig-like domains, and a tyrosine-phosphorylation site by its C-terminus. Mouse THSD1 shares 78% aa sequence identity with human THSD1. THSD1 is highly expressed in hematopoietic stem cells (HSCs) and progenitor cells, including CD34-/lowKit+Sca-1+Lin- HSCs, CD34+Kit+Sca-1+Lin- and Lin- progenitor cells, and to a lesser degree in thymic CD4-CD8- cells. Expression gradually decreases during T cell differentiation. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1's ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand. THSD1 may function in primitive hematopoietic cells in the bone marrow niche, and through its TSP1 and Ig-like domains, it may play a role in HSC homing to the niche following cell-to-cell contact to maintain hematopoietic stem cell quiescence.
THSD1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86930
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQ
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for THSD1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: THSD1 Antibody [NBP1-86930]
Immunocytochemistry/Immunofluorescence: THSD1 Antibody [NBP1-86930] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.Immunohistochemistry-Paraffin: THSD1 Antibody [NBP1-86930]
Immunohistochemistry-Paraffin: THSD1 Antibody [NBP1-86930] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.Western Blot: THSD1 Antibody - BSA Free [NBP1-86930]
Analysis in control (vector only transfected HEK293T lysate) and THSD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).Western Blot: THSD1 Antibody - BSA Free [NBP1-86930] -
THSD1 inactivation promotes autophagy in endothelial cells. (A) Representative images of GFP-LC3 puncta formation in control or THSD1-deficient HBMECs in the absence and presence of pepstatin (50 ug/mL)/E-64D (50 uM) treatment (abbreviated as P/E) for 6 h. Specifically, GFP-LC3 puncta formation in control cells without vs. with P/E treatment (A1 vs. A3) and THSD1-deficient cells without vs. with P/E treatment (A2 vs. A4). (B,C) Analysis of the effects of THSD1 inactivation on LC3 puncta formation (B) and autophagic flux (C) in control or THSD1-deficient cells. The number of LC3 puncta per cellular profile was quantified. (D) Western blot analysis of p62 protein levels in control or THSD1-deficient HBMECs, with quantification in (E). (F) Representative images of Western blots against ubiquitinated proteins using the FK1 antibody. GAPDH served as a loading control. (G) Fold changes were calculated after normalization to the total ubiquitinated protein level in the control sample (n = 3 independent experiments). * p < 0.05; ** p < 0.01. ns: not significant. Scale bar: 10 um. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/4/2139), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: THSD1 Antibody - BSA Free [NBP1-86930] -
THSD1-mediated autophagy is independent of mTOR or AMPK pathway. (A–C) Western blot analysis of whole cell lysates (WCL) from control or THSD1-deficient HBMECs using antibodies against p-S6K-T389, S6K, p-4E-BP1-37/46, and 4E-BP1. GAPDH served as a loading control. Quantification of p-S6K-T389 (B) and p-4E-BP1-T37/46 (C) levels was analyzed by Student’s t-test (n = 3 independent experiments). (D–I) Representative Western blots of WCL from control or THSD1-deficient HBMECs for analyzing AMPK signaling (D–F) or ULK1 activation (G–I). Quantification of p-AMPK alpha -T172 (E), p-ACC-S79 (F), p-ULK1-S757, and p-ULK1-S555 was analyzed by Student’s t-test (n = 3 independent experiments). ns: not significant. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/4/2139), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: THSD1 Antibody - BSA Free [NBP1-86930] -
THSD1-mediated autophagy is independent of mTOR or AMPK pathway. (A–C) Western blot analysis of whole cell lysates (WCL) from control or THSD1-deficient HBMECs using antibodies against p-S6K-T389, S6K, p-4E-BP1-37/46, and 4E-BP1. GAPDH served as a loading control. Quantification of p-S6K-T389 (B) and p-4E-BP1-T37/46 (C) levels was analyzed by Student’s t-test (n = 3 independent experiments). (D–I) Representative Western blots of WCL from control or THSD1-deficient HBMECs for analyzing AMPK signaling (D–F) or ULK1 activation (G–I). Quantification of p-AMPK alpha -T172 (E), p-ACC-S79 (F), p-ULK1-S757, and p-ULK1-S555 was analyzed by Student’s t-test (n = 3 independent experiments). ns: not significant. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/4/2139), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: THSD1 Antibody - BSA Free [NBP1-86930] -
THSD1-mediated autophagy is independent of mTOR or AMPK pathway. (A–C) Western blot analysis of whole cell lysates (WCL) from control or THSD1-deficient HBMECs using antibodies against p-S6K-T389, S6K, p-4E-BP1-37/46, and 4E-BP1. GAPDH served as a loading control. Quantification of p-S6K-T389 (B) and p-4E-BP1-T37/46 (C) levels was analyzed by Student’s t-test (n = 3 independent experiments). (D–I) Representative Western blots of WCL from control or THSD1-deficient HBMECs for analyzing AMPK signaling (D–F) or ULK1 activation (G–I). Quantification of p-AMPK alpha -T172 (E), p-ACC-S79 (F), p-ULK1-S757, and p-ULK1-S555 was analyzed by Student’s t-test (n = 3 independent experiments). ns: not significant. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/4/2139), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for THSD1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 28576485). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: THSD1
Long Name
Thrombospondin, Type I, Domain Containing 1
Alternate Names
TMTSP
Gene Symbol
THSD1
Additional THSD1 Products
Product Documents for THSD1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for THSD1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for THSD1 Antibody - BSA Free
Customer Reviews for THSD1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review THSD1 Antibody - BSA Free and earn rewards!
Have you used THSD1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...