Thymidylate Synthase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17004

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Thymidylate Synthase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Thymidylate Synthase Antibody - BSA Free

Western Blot: Thymidylate Synthase Antibody [NBP3-17004]

Western Blot: Thymidylate Synthase Antibody [NBP3-17004]

Western Blot: Thymidylate Synthase Antibody [NBP3-17004] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: Thymidylate Synthase Antibody [NBP3-17004]

Immunocytochemistry/ Immunofluorescence: Thymidylate Synthase Antibody [NBP3-17004]

Immunocytochemistry/Immunofluorescence: Thymidylate Synthase Antibody [NBP3-17004] - Analysis in human tonsil and skeletal muscle tissues using Anti-TYMS antibody. Corresponding TYMS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody [NBP3-17004]

Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody [NBP3-17004]

Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody [NBP3-17004] - Staining of human tonsil shows high expression.
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody [NBP3-17004]

Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody [NBP3-17004]

Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody [NBP3-17004] - Staining of human skeletal muscle shows low expression as expected.

Applications for Thymidylate Synthase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Thymidylate Synthase

Thymidylate synthase (TS) is an intracellular enzyme critical for de novo synthesis of DNA. In cancer, expression of TS is often elevated and becomes further elevated as a result of treatment with the most commonly used chemotherapeutic, 5-fluorouracil (5-FU). Resistance or lack of response to 5-FU is attributed to the elevation of TS activity. Overexpression of TS has been demonstrated in many types of tumors including breast, colon, gastric and melanoma and is usually predictive of shortened survival time.

Long Name

Thymidylate synthase

Alternate Names

EC 2.1.1.45, OK/SW-cl.29, TS, TSase, TYMS

Gene Symbol

TYMS

Additional Thymidylate Synthase Products

Product Documents for Thymidylate Synthase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Thymidylate Synthase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Thymidylate Synthase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Thymidylate Synthase Antibody - BSA Free and earn rewards!

Have you used Thymidylate Synthase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies