Thymosin beta 4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00007114-B01P

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

TMSB4X (AAH01631.1, 1 a.a. - 44 a.a.) full-length human protein. MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Specificity

TMSB4X - thymosin, beta 4, X-linked,

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for Thymosin beta 4 Antibody - Azide and BSA Free

Western Blot: Thymosin beta 4 Antibody [H00007114-B01P]

Western Blot: Thymosin beta 4 Antibody [H00007114-B01P]

Thymosin-beta-4-Antibody-Western-Blot-H00007114-B01P-img0005.jpg
Immunocytochemistry/ Immunofluorescence: Thymosin beta 4 Antibody [H00007114-B01P]

Immunocytochemistry/ Immunofluorescence: Thymosin beta 4 Antibody [H00007114-B01P]

Immunocytochemistry/Immunofluorescence: Thymosin beta 4 Antibody [H00007114-B01P] - Analysis of purified antibody to TMSB4X on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Thymosin beta 4 Antibody [H00007114-B01P]

Western Blot: Thymosin beta 4 Antibody [H00007114-B01P]

Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - Analysis of TMSB4X expression in transfected 293T cell line by TMSB4X polyclonal antibody. Lane 1: TMSB4X transfected lysate(4.84 KDa). Lane 2: Non-transfected lysate.
Thymosin beta 4 Antibody

Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] -

Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - No effect of T beta 4 on upstream-deleted mutant of NPHP3-promoter (pmt.). (a) Mutant (mt.) NPHP3-promoter plasmids were prepared from wildtype (wt.) promoter. (b–e) HeLa cells were transfected with pCMV-2B or pCMV-T beta 4 for 24 h. (b) HeLa cells were co-transfected with wildtype or mutant pEZX-PG02-NPHP3-promoter Gluc plasmid. & Gluc activity in cultured media was measured with luminometer using Gluc substrate. Bar graph indicates the mean of NPHP3-promoter activity. (c) Expression level of T beta 4 & NPHP3 transcripts were measured by RT-PCR. (d) The cells were fixed & stained with antibody against Ac-tubulin (red) & DAPI (blue). (e) The ciliated cells in pCMV-2B- (white) or pCMV-T beta 4-transfected group (grey) were counted. (f) Mutant (mt.) T beta 4-promoter plasmids were prepared from wildtype (wt.) promoter. (g,h) HeLa cells were transfected with pCDNA3.1 or pCDNA6-NPH3 for 24 h. (g) HeLa cells were co-transfected with wildtype or mutant pEZX-PG02-T beta 4-promoter Gluc plasmid. & Gluc activity in cultured media was measured with luminometer using Gluc substrate. Bar graph indicates the mean of T beta 4-promoter activity. (h) Expression level of T beta 4 & NPHP3 transcripts were measured by RT-PCR. Processing (such as changing brightness & contrast) is applied equally to controls across the entire image (c,d & h). Data in a bar graph represent the means ± SEM. **p < 0.01; significantly different from control group. &&p < 0.01; significantly different from wildtype promoter plasmid-transfected group. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31048733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Thymosin beta 4 Antibody

Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] -

Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - Effect of T beta 4 on primary cilia formation in HeLa cells. (a) HeLa ells were incubated in serum-starved media with 0.1% FBS for 36 h. The cells were fixed & stained with antibody against Ac-tubulin (green) or NPHP3 (red). The representative fluorescence image of primary cilia was shown. (b) Overlay of fluorescence intensity of Ac-tubulin (green) & NPHP3 (red) through the whole length of primary cilia was shown in line graph (Line scan * → ** in a, right). (c,d) Cells were transfected with AccuTarget™ negative control siRNA (NC) or T beta 4-siRNA for 24 h. (c) The mRNA (upper) & protein (lower) expression of T beta 4 were shown. (d) The cells were incubated in serum-starved media for 36 h, fixed & stained with antibody against Ac-tubulin (green) & DAPI (blue). The ciliated cells in AccuTarget™ negative control siRNA-treated (white) & T beta 4-knockdown cells (grey) were counted (n > 500 cells). (e,f) Cells were transfected with pEGFP-2B or pEGFP-T beta 4 plasmid for 24 h. (e) The expression of GFP & T beta 4-GFP were detected with GFP antibody. (f) The cells were fixed & stained with antibody against Ac-tubulin (red) & DAPI (blue). The ciliated cells in GFP (white) or T beta 4-GFP-positive cells (grey) were counted. Processing (such as changing brightness & contrast) is applied equally to controls across the entire image. Data in a bar graph represent the means ± SEM. **p < 0.01; significantly different from control cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31048733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Thymosin beta 4 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:500

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Thymosin beta 4

This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq]

Alternate Names

TB4X, THYB4, TMSB4, TMSB4X

Entrez Gene IDs

7114 (Human)

Gene Symbol

TMSB4X

Additional Thymosin beta 4 Products

Product Documents for Thymosin beta 4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Thymosin beta 4 Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Thymosin beta 4 Antibody - Azide and BSA Free

Customer Reviews for Thymosin beta 4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Thymosin beta 4 Antibody - Azide and BSA Free and earn rewards!

Have you used Thymosin beta 4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...