Tight Junction Protein 2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86850
Loading...
Key Product Details
Validated by
Orthogonal Validation, Biological Validation
Species Reactivity
Validated:
Human
Cited:
Mouse
Predicted:
Rat (91%). Backed by our 100% Guarantee.
Applications
Validated:
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 28420508) and a verfied customer review.
Marker
Intercellular Junctions Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Tight Junction Protein 2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850]
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Green: CD31 Red: Tight Junction Protein 2 Blue: Nuclei. Lung frozen section was blocked and stained with TJP-2 at 1:100 dilution for a hour. A secondary Alexa 555-conjugated goat anti-rabbit antibody was used for labeling. Section was aso co-stained with CD31 antibody in conjunction with an Alexa 488-conjugated antibody. Nuclei was revealed by DAPU staining. Image submitted by a verified customer review.Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850]
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm and cell junctions. Antibody staining is shown in green.Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850]
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining in primary mouse lung endothelial cells. Image submitted by a verified customer review.Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody - BSA Free [NBP1-86850]
Staining of human testis shows strong membranous and cytoplasmic positivity in cells in seminiferous ducts.Western Blot: Tight Junction Protein 2 Antibody [NBP1-86850]
Western Blot: Tight Junction Protein 2 Antibody [NBP1-86850] - Primary mouse lung endothelial cells treated with or without control IgG was blotted with the anti-TJP-2 antibody. Primary Antibody diluted 1:1000. Image submitted by a verified customer review.Immunoprecipitation: Tight Junction Protein 2 Antibody [NBP1-86850]
Immunoprecipitation: Tight Junction Protein 2 Antibody [NBP1-86850] - HEK293 cells were lysed and immunoprecipitated wtih anti-TJP2 ab (NBP1-86850) and Protein A/G PLUS-Agarose. The precipitates were separated by SDS-PAGE and blotted with anti-ZO1 antibody. IP image submitted by a verified customer review.Applications for Tight Junction Protein 2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25 - 2 ug/mL
Immunoprecipitation
Validated from a verified customer review
Western Blot
0.04 - 0.4 ug/mL
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 5 reviews rated 4.6 using NBP1-86850 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Tight Junction Protein 2
Alternate Names
C9DUPq21.11, DFNA51, DUP9q21.11, MGC26306, Tight junction protein 2, tight junction protein 2 (zona occludens 2), TJP2, X104, X104tight junction protein ZO-2, ZO2, ZO-2, ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2), Zona occludens protein 2, Zonula occludens protein 2
Gene Symbol
TJP2
Additional Tight Junction Protein 2 Products
Product Documents for Tight Junction Protein 2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Tight Junction Protein 2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Tight Junction Protein 2 Antibody - BSA Free
Customer Reviews for Tight Junction Protein 2 Antibody - BSA Free (5)
4.6 out of 5
5 Customer Ratings
Have you used Tight Junction Protein 2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
5 of
5 reviews
Showing All
Filter By:
-
Application: ImmunoprecipitationSample Tested: 293 whole cell lysateSpecies: HumanVerified Customer | Posted 06/18/2021Western blotting result with immunoprecipitation experiments. HEK293 cells were lysed and immunoprecipitated wtih anti-TJP2 ab (NBP1-86850) and Protein A/G PLUS-Agarose. The precipitates underwent SDS-PAGE and blotted with anti-ZO1 antibody.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
-
Application: Immunohistochemistry-ParaffinSample Tested: human skinSpecies: HumanVerified Customer | Posted 04/11/2019
-
Application: ImmunocytochemistrySample Tested: Frozen Tissue and Mouse lung frozen sectionSpecies: MouseVerified Customer | Posted 05/17/2017Green: CD31 Red: Tight Junction Protein 2 Blue: NucleiLung frozen section was blocked and stained with TJP-2 @ 1:100 dilution for a hour. A secondary Alexa 555-conjugated goat anti-rabbit antibody was used for labeling. Section was aso co-stained with CD31 antibody in conjunction with an Alexa 488-conjugated antibody. Nuclei was revealed by DAPU staining.
-
Application: Western BlotSample Tested: Primary mouse lung endothelial cellsSpecies: MouseVerified Customer | Posted 05/11/2017Primary mouse lung endothelial cells treated with or without control IgG was blotted with the anti-TJP-2 antibody.The antibody was diluted in PBST contained 5% milk at 1:1000. The secondary antibody was diluted at 1:5000.
-
Application: Immunocytochemistry/ImmunofluorescenceSample Tested: Primary mouse lung endothelial cellsSpecies: Primary mouse lung endothelial cells and MouseVerified Customer | Posted 10/13/2016The primary mouse lung endothelial cell was fixed, permeabilized and stained with 1:50 diluted anti-ZO-2 ab (NBP1-86850) for overnight. Cell was washed and was then incubated with Alexa flur546 dye for 1-hour in room temperature.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...