TLR7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32483

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TLR7 Antibody - BSA Free

Immunohistochemistry-Paraffin: TLR7 Antibody [NBP2-32483]

Immunohistochemistry-Paraffin: TLR7 Antibody [NBP2-32483]

Immunohistochemistry-Paraffin: TLR7 Antibody [NBP2-32483] - Analysis in human lymph node and skeletal muscle tissues using NBP2-32483 antibody. Corresponding TLR7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TLR7 Antibody [NBP2-32483]

Immunohistochemistry-Paraffin: TLR7 Antibody [NBP2-32483]

Immunohistochemistry-Paraffin: TLR7 Antibody [NBP2-32483] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: TLR7 Antibody [NBP2-32483]

Immunohistochemistry-Paraffin: TLR7 Antibody [NBP2-32483]

Immunohistochemistry-Paraffin: TLR7 Antibody [NBP2-32483] - Staining of human pancreas shows low expression as expected.

Applications for TLR7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TLR7

Toll-like receptor 7 (TLR7) is a type I transmembrane protein expressed on the surface of endosomes and has a role in pathogen-associated molecular patterns (PAMPs) recognition and host defense (1-3). TLR7 is primarily expressed in the brain, placenta, spleen, stomach, and lungs (4). TLR7 recognizes microbial single stranded RNA (ssRNA), specifically guanosine and its derivatives (1-3). Human TLR7 cDNA encodes a 1049 amino acid (aa) protein with a theoretical molecular weight (MW) of 120.9 kDa (4). The TLR7 protein consists of a signal sequence, an 813 aa extracellular domain containing leucine-rich repeats (LRRs) which form a horseshoe-like shape, a 21 aa transmembrane domain, and a 189 aa cytoplasmic domain with cytosolic Toll-interleukin-1 receptor homology (TIR) domains (1,2,4). TLR7 and its fellow subfamily members, TLR8 and TLR9, possess a characteristic Z-loop between two LRRs with proteolytic Z-loop processing required for TLR activation (2). Z-loop cleavage in TLR7 allows for guanosine and uridine-rich ssRNA binding to the 1st and 2nd ligand binding site, respectively (2). The TIR domain associates with the adaptor protein myeloid differentiation primary response protein (MyD88) to initiate downstream signaling (1-3,5,6). Following activation by PAMPs, TLR7 dimerizes and bound MyD88 interacts with interleukin-1 receptor-associated kinase-4 (IRAK-4) (1,5). Together the complex recruits IRAK-1 and IRAK-2, which become phosphorylated, and interact with tumor necrosis factor receptor-associated factor 6 (TRAF6) (1,5). TRAF6 induces the activation of mitogen-activated protein kinase (MAPK), nuclear factor-kappaB (NF-kappaB), and interferon-regulatory factor 7 (IRF7), leading to interferon production and pro-inflammatory cytokine secretion associated with immune response (1,5).

While TLRs play an important role in innate immune response, dysfunction in the TLR-MyD88 signaling cascade has also been reported in various autoimmune disorders (5,6). Elevated expression of TLR7 is associated with increased risk of system lupus erythematosus (SLE), an autoimmune disease involving B cell hyperactivity (6,7). Studies involving mouse models has also found that increased TLR7 expression predisposes mice to a lupus-like disease (7). Therapeutics targeting TLR7 have been developed to either enhance or inhibit its activity depending on the circumstance. For example, TLR7 agonists such as imiquimod, resiquimod, and 852A are used to increase TLR7 activity for treatment of cancers and to fight viral infections (7,8). On the other hand, TLR7 antagonists inhibit its activation and have been developed to combat chronic immune stimulation as seen in inflammatory and autoimmune diseases (8).

References

1. Petes C, Odoardi N, Gee K. The Toll for Trafficking: Toll-Like Receptor 7 Delivery to the Endosome. Front Immunol. 2017;8:1075. https://doi.org/10.3389/fimmu.2017.01075

2. Maeda K, Akira S. TLR7 Structure: Cut in Z-Loop. Immunity. 2016;45(4):705-707. https://doi.org/10.1016/j.immuni.2016.10.003

3. Krieg AM, Vollmer J. Toll-like receptors 7, 8, and 9: linking innate immunity to autoimmunity. Immunol Rev. 2007;220:251-269. https://doi.org/10.1111/j.1600-065X.2007.00572.x

4. Uniprot (Q9NYK1)

5. Zheng C, Chen J, Chu F, Zhu J, Jin T. Inflammatory Role of TLR-MyD88 Signaling in Multiple Sclerosis. Front Mol Neurosci. 2020;12:314. https://doi.org/10.3389/fnmol.2019.00314

6. Chi H, Li C, Zhao FS, et al. Anti-tumor Activity of Toll-Like Receptor 7 Agonists. Front Pharmacol. 2017;8:304. https://doi.org/10.3389/fphar.2017.00304

7. Fillatreau S, Manfroi B, Dorner T. Toll-like receptor signalling in B cells during systemic lupus erythematosus. Nat Rev Rheumatol. 2021;17(2):98-108. https://doi.org/10.1038/s41584-020-00544-4

8. Patinote C, Karroum NB, Moarbess G, et al. Agonist and antagonist ligands of toll-like receptors 7 and 8: Ingenious tools for therapeutic purposes. Eur J Med Chem. 2020;193:112238. https://doi.org/10.1016/j.ejmech.2020.112238

Long Name

Toll-like Receptor 7

Alternate Names

toll-like receptor 7

Gene Symbol

TLR7

Additional TLR7 Products

Product Documents for TLR7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TLR7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TLR7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TLR7 Antibody - BSA Free and earn rewards!

Have you used TLR7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies