TMEM103 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91733
Loading...
Key Product Details
Validated by
Biological Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for TMEM103 Antibody - BSA Free
Immunohistochemistry: TMEM103 Antibody [NBP1-91733]
TMEM103-Antibody-Immunohistochemistry-NBP1-91733-img0005.jpgWestern Blot: TMEM103 Antibody [NBP1-91733]
Western Blot: C3orf75/ELP6 Antibody [NBP1-91733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissueImmunohistochemistry-Paraffin: TMEM103 Antibody [NBP1-91733]
Immunohistochemistry-Paraffin: C3orf75/ELP6 Antibody [NBP1-91733] - Staining of human pancreas shows distinct granular cytoplasmic positivity in exocrine glandular cells.Western Blot: TMEM103 Antibody [NBP1-91733] -
Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity & stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, including ELP1, ELP2, ELP3, ELP4, ELP6. b ELP5 depletion significantly decreased ATPase activity in NOZ cells. c The abundance of thiolated tEUUC tRNA was decreased in ELP5-depleted NOZ cells. d Ectopically expressed ELP5 could interact with ELP3 & ELP4 in GBC cells. e Endogenous ELP3 & ELP4 degraded rapidly after treatment with 50 µg ml−1 cycloheximide (CHX) in ELP5-depleted GBC cells compared with WT cells. f–h Ectopically expressed ELP5 (f) could promote or rescue thiolated tRNA abundance (g) & GEM sensitivity (h) in WT & ELP5-depleted GBC cells, but ectopically expressed ELP3 or ELP4 (f) could only increase the abundance of thiolated tRNA (g) & GEM sensitivity (h) in WT cells, not in ELP5-depleted cells. i, j Mutation of the ATPase activity site residue within ELP5 (D124A) (i) could not promote GEM sensitivity in GBC cells (j). k, l Mutation of the cm5U catalytic activity site residue with ELP3 (C109/112 S) (k) could not promote GEM sensitivity in GBC cells (l). Data represent the mean ± S.D., n = 3 independent experiments in b, h, j, l, error bars represent S.D. Unpaired Student’s t-tests were used in b, h (NS, non-significant, **P < 0.01 & ***P < 0.001). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31792210), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for TMEM103 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TMEM103
Alternate Names
Angiotonin-transactivated protein 1, ATP1, C3orf75, chromosome 3 open reading frame 75, elongator acetyltransferase complex subunit 6, ELP6, FLJ20211, Protein TMEM103, TMEM103, transmembrane protein 103
Gene Symbol
ELP6
Additional TMEM103 Products
Product Documents for TMEM103 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TMEM103 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TMEM103 Antibody - BSA Free
Customer Reviews for TMEM103 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TMEM103 Antibody - BSA Free and earn rewards!
Have you used TMEM103 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...