TMEM103 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91733

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TMEM103 Antibody - BSA Free

Immunohistochemistry: TMEM103 Antibody [NBP1-91733]

Immunohistochemistry: TMEM103 Antibody [NBP1-91733]

TMEM103-Antibody-Immunohistochemistry-NBP1-91733-img0005.jpg
Western Blot: TMEM103 Antibody [NBP1-91733]

Western Blot: TMEM103 Antibody [NBP1-91733]

TMEM103-Antibody-Western-Blot-NBP1-91733-img0006.jpg
Western Blot: TMEM103 Antibody [NBP1-91733]

Western Blot: TMEM103 Antibody [NBP1-91733]

Western Blot: C3orf75/ELP6 Antibody [NBP1-91733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: TMEM103 Antibody [NBP1-91733]

Immunohistochemistry-Paraffin: TMEM103 Antibody [NBP1-91733]

Immunohistochemistry-Paraffin: C3orf75/ELP6 Antibody [NBP1-91733] - Staining of human pancreas shows distinct granular cytoplasmic positivity in exocrine glandular cells.
TMEM103 Antibody

Western Blot: TMEM103 Antibody [NBP1-91733] -

Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity & stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, including ELP1, ELP2, ELP3, ELP4, ELP6. b ELP5 depletion significantly decreased ATPase activity in NOZ cells. c The abundance of thiolated tEUUC tRNA was decreased in ELP5-depleted NOZ cells. d Ectopically expressed ELP5 could interact with ELP3 & ELP4 in GBC cells. e Endogenous ELP3 & ELP4 degraded rapidly after treatment with 50 µg ml−1 cycloheximide (CHX) in ELP5-depleted GBC cells compared with WT cells. f–h Ectopically expressed ELP5 (f) could promote or rescue thiolated tRNA abundance (g) & GEM sensitivity (h) in WT & ELP5-depleted GBC cells, but ectopically expressed ELP3 or ELP4 (f) could only increase the abundance of thiolated tRNA (g) & GEM sensitivity (h) in WT cells, not in ELP5-depleted cells. i, j Mutation of the ATPase activity site residue within ELP5 (D124A) (i) could not promote GEM sensitivity in GBC cells (j). k, l Mutation of the cm5U catalytic activity site residue with ELP3 (C109/112 S) (k) could not promote GEM sensitivity in GBC cells (l). Data represent the mean ± S.D., n = 3 independent experiments in b, h, j, l, error bars represent S.D. Unpaired Student’s t-tests were used in b, h (NS, non-significant, **P < 0.01 & ***P < 0.001). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31792210), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TMEM103 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMEM103

Alternate Names

Angiotonin-transactivated protein 1, ATP1, C3orf75, chromosome 3 open reading frame 75, elongator acetyltransferase complex subunit 6, ELP6, FLJ20211, Protein TMEM103, TMEM103, transmembrane protein 103

Gene Symbol

ELP6

Additional TMEM103 Products

Product Documents for TMEM103 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMEM103 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TMEM103 Antibody - BSA Free

Customer Reviews for TMEM103 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMEM103 Antibody - BSA Free and earn rewards!

Have you used TMEM103 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...