TOX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13464

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: IAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPPN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TOX2 Antibody - BSA Free

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464]

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464]

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining in human lymph node and skeletal muscle tissues.. Corresponding TOX2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: TOX2 Antibody [NBP2-13464]

Immunocytochemistry/ Immunofluorescence: TOX2 Antibody [NBP2-13464]

Immunocytochemistry/Immunofluorescence: TOX2 Antibody [NBP2-13464] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464]

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464]

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464]

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464]

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464]

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464]

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
TOX2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: TOX2 Antibody - BSA Free [NBP2-13464]

Immunocytochemistry/ Immunofluorescence: TOX2 Antibody - BSA Free [NBP2-13464]

Staining of human cell line A-431 shows localization to nucleoplasm.
TOX2 Antibody - BSA Free Immunohistochemistry: TOX2 Antibody - BSA Free [NBP2-13464]

Immunohistochemistry: TOX2 Antibody - BSA Free [NBP2-13464]

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for TOX2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TOX2

Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system.

Alternate Names

C20orf100, chromosome 20 open reading frame 100, dJ495O3.1, GCX1, GCX-1dJ1108D11.2, granulosa cell HMG box 1, Granulosa cell HMG box protein 1, granulosa cell HMG-box protein 1, MGC15880, TOX high mobility group box family member 2

Gene Symbol

TOX2

Additional TOX2 Products

Product Documents for TOX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TOX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TOX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TOX2 Antibody - BSA Free and earn rewards!

Have you used TOX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...