TPPP/p25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80962

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TPPP/p25 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TPPP/p25 Antibody - BSA Free

Western Blot: TPPP/p25 Antibody [NBP1-80962]

Western Blot: TPPP/p25 Antibody [NBP1-80962]

Western Blot: TPPP/p25 Antibody [NBP1-80962] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-592
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human cerebral cortex shows nuclear and cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human lymph node.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human placenta shows no positivity in trophoblastic cells and weak cytoplasmic and nuclear staining in Hofbauer cells.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human pancreas shows cytoplasmicand nuclear positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human liver.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human colon.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human cerebral cortex, liver, lower gastrointestinal and pancreas using Anti-TPPP antibody NBP1-80962 (A) shows similar protein distribution across tissues to independent antibody NBP2-34031 (B).
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Analysis in human cerebral cortex and liver tissues using NBP1-80962 antibody. Corresponding TPPP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962]

Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human lower gastrointestinal shows moderate cytoplasmic positivity in peripheral ganglion.

Applications for TPPP/p25 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TPPP/p25

TPPP may play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity ofthe microtubule network. May play a role in mitotic spindle assembly and nuclear env

Alternate Names

p24, P24,25 kDa brain-specific protein, P25, p25alpha, p25-alpha, TPPP/p25brain specific protein p25 alpha, TPPP1glycogen synthase kinase 3 (GSK3) inhibitor p24, tubulin polymerization promoting protein, tubulin polymerization-promoting protein

Entrez Gene IDs

11076 (Human); 72948 (Mouse)

Gene Symbol

TPPP

UniProt

O94811 (Human)

Additional TPPP/p25 Products

Product Documents for TPPP/p25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TPPP/p25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TPPP/p25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TPPP/p25 Antibody - BSA Free and earn rewards!

Have you used TPPP/p25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies