TRAF7 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04330

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all TRAF7 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 380-479 of human TRAF7 (NP_115647.2). YDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYKCQKTLEGHDGIVLALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIRAHD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TRAF7 Antibody - Azide and BSA Free

Western Blot: TRAF7 AntibodyAzide and BSA Free [NBP3-04330]

Western Blot: TRAF7 AntibodyAzide and BSA Free [NBP3-04330]

Western Blot: TRAF7 Antibody [NBP3-04330] - Western blot analysis of extracts of various cell lines, using TRAF7 antibody (NBP3-04330) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: TRAF7 Antibody - Azide and BSA Free [NBP3-04330]

Immunohistochemistry-Paraffin: TRAF7 Antibody - Azide and BSA Free [NBP3-04330]

Immunohistochemistry-Paraffin: TRAF7 Antibody [NBP3-04330] - Immunohistochemistry of paraffin-embedded human colon carcinoma using TRAF7 antibody (NBP3-04330) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
TRAF7 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TRAF7 Antibody - Azide and BSA Free [TRAF7] -

Immunocytochemistry/ Immunofluorescence: TRAF7 Antibody - Azide and BSA Free [TRAF7] - Immunofluorescence analysis of U2OS cells using TRAF7 Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
TRAF7 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TRAF7 Antibody - Azide and BSA Free [TRAF7] -

Immunocytochemistry/ Immunofluorescence: TRAF7 Antibody - Azide and BSA Free [TRAF7] - Immunofluorescence analysis of NIH/3T3 cells using TRAF7 Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
TRAF7 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TRAF7 Antibody - Azide and BSA Free [TRAF7] -

Immunocytochemistry/ Immunofluorescence: TRAF7 Antibody - Azide and BSA Free [TRAF7] - Immunofluorescence analysis of PC-12 cells using TRAF7 Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for TRAF7 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TRAF7

Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding

Alternate Names

DKFZp586I021, E3 ubiquitin-protein ligase TRAF7, EC 6.3.2.-, MGC7807, RFWD1RING finger protein 119, RNF119RING finger and WD repeat-containing protein 1, TNF receptor-associated factor 7ring finger and WD repeat domain 1

Gene Symbol

TRAF7

Additional TRAF7 Products

Product Documents for TRAF7 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRAF7 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRAF7 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TRAF7 Antibody - Azide and BSA Free and earn rewards!

Have you used TRAF7 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies