Transaldolase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88109

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Transaldolase 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109]

Immunocytochemistry/ Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109]

Immunocytochemistry/Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Transaldolase 1 Antibody - BSA Free Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Analysis using Anti-TALDO1 antibody NBP1-88109 (A) shows similar pattern to independent antibody NBP2-56305 (B).
Transaldolase 1 Antibody - BSA Free Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Transaldolase 1 Antibody - BSA Free Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Western Blot: Transaldolase 1 Antibody - BSA Free [NBP1-88109]

Analysis in human cell line HepG2.

Applications for Transaldolase 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Transaldolase 1

Transaldolase 1 is a key enzyme of the nonoxidative pentose phosphate pathway providing ribose-5-phosphate for nucleic acid synthesis and NADPH for lipid biosynthesis. This pathway can also maintain glutathione at a reduced state and thus protect sulfhydryl groups and cellular integrity from oxygen radicals. The functional gene of transaldolase 1 is located on chromosome 11 and a pseudogene is identified on chromosome 1 but there are conflicting map locations. The second and third exon of this gene were developed by insertion of a retrotransposable element. This gene is thought to be involved in multiple sclerosis. [provided by RefSeq]

Alternate Names

dihydroxyacetone transferase, EC 2.2.1.2, glycerone transferase, TAL, TALDO, TALDOR, TALH, TAL-H, transaldolase, transaldolase 1

Gene Symbol

TALDO1

Additional Transaldolase 1 Products

Product Documents for Transaldolase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Transaldolase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Transaldolase 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Transaldolase 1 Antibody - BSA Free and earn rewards!

Have you used Transaldolase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...