TRBP Antibody (9E6C9)

Novus Biologicals | Catalog # NBP3-16753

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9E6C9 expressed in HEK293
View all TRBP Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TRBP (Q15633). RFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRBP Antibody (9E6C9)

Western Blot: TRBP Antibody (9E6C9) [NBP3-16753]

Western Blot: TRBP Antibody (9E6C9) [NBP3-16753]

Western Blot: TRBP Antibody (9E6C9) [NBP3-16753] - Western blot analysis of extracts of various cell lines, using TRBP Rabbit mAb (NBP3-16753) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
TRBP Antibody (9E6C9)

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] -

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] - Immunohistochemistry analysis of TRBP in paraffin-embedded human lung cancer tissue using TRBP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
TRBP Antibody (9E6C9)

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] -

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] - Immunohistochemistry analysis of TRBP in paraffin-embedded mouse kidney tissue using TRBP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
TRBP Antibody (9E6C9)

Immunocytochemistry/ Immunofluorescence: TRBP Antibody (9E6C9) [NBP3-16753] -

Immunocytochemistry/ Immunofluorescence: TRBP Antibody (9E6C9) [NBP3-16753] - Confocal imaging of paraffin-embedded Mouse brain tissue using TRBP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
TRBP Antibody (9E6C9)

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] -

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] - Immunohistochemistry analysis of TRBP in paraffin-embedded human lung tissue using TRBP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
TRBP Antibody (9E6C9)

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] -

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] - Immunohistochemistry analysis of TRBP in paraffin-embedded rat brain tissue using TRBP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
TRBP Antibody (9E6C9)

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] -

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] - Immunohistochemistry analysis of TRBP in paraffin-embedded human liver tissue using TRBP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
TRBP Antibody (9E6C9)

Immunocytochemistry/ Immunofluorescence: TRBP Antibody (9E6C9) [NBP3-16753] -

Immunocytochemistry/ Immunofluorescence: TRBP Antibody (9E6C9) [NBP3-16753] - Confocal imaging of NIH/3T3 cells using TRBP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
TRBP Antibody (9E6C9)

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] -

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] - Immunohistochemistry analysis of TRBP in paraffin-embedded human thyroid cancer tissue using TRBP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
TRBP Antibody (9E6C9)

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] -

Immunohistochemistry: TRBP Antibody (9E6C9) [NBP3-16753] - Immunohistochemistry analysis of TRBP in paraffin-embedded mouse lung tissue using TRBP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for TRBP Antibody (9E6C9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TRBP

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene.

Alternate Names

LOQS, RISC-loading complex subunit TARBP2, TAR (HIV) RNA binding protein 2, TAR (HIV) RNA-binding protein 2, TAR (HIV) RNA-binding protein TRBP1, TAR (HIV-1) RNA binding protein 2, TAR RNA binding protein 2, TAR RNA-binding protein 2, trans-activation responsive RNA-binding protein, Trans-activation-responsive RNA-binding protein, TRBP, TRBP1, TRBP2

Gene Symbol

TARBP2

Additional TRBP Products

Product Documents for TRBP Antibody (9E6C9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRBP Antibody (9E6C9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRBP Antibody (9E6C9)

There are currently no reviews for this product. Be the first to review TRBP Antibody (9E6C9) and earn rewards!

Have you used TRBP Antibody (9E6C9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies