Tropomodulin 3 Antibody (1E1) - Azide and BSA Free

Novus Biologicals | Catalog # H00029766-M10

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1E1

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

TMOD3 (NP_055362, 280 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ

Specificity

TMOD3 - tropomodulin 3 (ubiquitous) (1E1)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for Tropomodulin 3 Antibody (1E1) - Azide and BSA Free

Western Blot: Tropomodulin 3 Antibody (1E1) [H00029766-M10]

Western Blot: Tropomodulin 3 Antibody (1E1) [H00029766-M10]

Western Blot: Tropomodulin 3 Antibody (1E1) [H00029766-M10] - Analysis of TMOD3 expression in human kidney.
Immunocytochemistry/ Immunofluorescence: Tropomodulin 3 Antibody (1E1) [H00029766-M10]

Immunocytochemistry/ Immunofluorescence: Tropomodulin 3 Antibody (1E1) [H00029766-M10]

Immunocytochemistry/Immunofluorescence: Tropomodulin 3 Antibody (1E1) [H00029766-M10] - Analysis of monoclonal antibody to TMOD3 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: Tropomodulin 3 Antibody (1E1) [H00029766-M10]

Western Blot: Tropomodulin 3 Antibody (1E1) [H00029766-M10]

Western Blot: Tropomodulin 3 Antibody (1E1) [H00029766-M10] - Analysis of TMOD3 expression in transfected 293T cell line by TMOD3 monoclonal antibody (M10), clone 1E1. Lane 1: TMOD3 transfected lysate (Predicted MW: 39.6 KDa). Lane 2: Non-transfected lysate.
Sandwich ELISA: Tropomodulin 3 Antibody (1E1) [H00029766-M10] - Detection limit for recombinant GST tagged TMOD3 is 1 ng/ml as a capture antibody.

Applications for Tropomodulin 3 Antibody (1E1) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Tropomodulin 3

Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton

Alternate Names

tropomodulin 3 (ubiquitous), tropomodulin-3, Ubiquitous tropomodulin, UTMOD, U-Tmod

Entrez Gene IDs

29766 (Human)

Gene Symbol

TMOD3

Additional Tropomodulin 3 Products

Product Documents for Tropomodulin 3 Antibody (1E1) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tropomodulin 3 Antibody (1E1) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tropomodulin 3 Antibody (1E1) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Tropomodulin 3 Antibody (1E1) - Azide and BSA Free and earn rewards!

Have you used Tropomodulin 3 Antibody (1E1) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...