Troponin I type 2 (fast skeletal) Antibody (2H7S10)
Novus Biologicals | Catalog # NBP3-16474
Recombinant Monoclonal Antibody
![Western Blot: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]](https://resources.rndsystems.com/images/products/Troponin-I-type-2-fast-skeletal-Antibody-2H7S10-Western-Blot-NBP3-16474-img0002.jpg "Western Blot: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]")
Loading...
Key Product Details
Species Reactivity
Mouse, Rat
Applications
Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 2H7S10 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 83-182 of human Troponin I type 2 (fast skeletal) (P48788). EVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Troponin I type 2 (fast skeletal) Antibody (2H7S10)
Western Blot: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]
Western Blot: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474] - Western blot analysis of extracts of various cell lines, using Troponin I2 (Troponin I type 2 (fast skeletal)) Rabbit mAb (NBP3-16474) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.![Immunohistochemistry: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]](https://resources.rndsystems.com/images/products/Troponin-I-type-2-fast-skeletal-Antibody-2H7S10-Immunohistochemistry-NBP3-16474-img0001.jpg "Immunohistochemistry: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]")
Immunohistochemistry: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474]
Immunohistochemistry: Troponin I type 2 (fast skeletal) Antibody (2H7S10) [NBP3-16474] - Immunofluorescence analysis of mouse bone marrow using Troponin I2 (Troponin I type 2 (fast skeletal)) Rabbit mAb (NBP3-16474) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Applications for Troponin I type 2 (fast skeletal) Antibody (2H7S10)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Troponin I type 2 (fast skeletal)
Alternate Names
skeletal, fast, troponin I type 2 (skeletal, fast), troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, troponin I, fast-twitch skeletal muscle isoform
Gene Symbol
TNNI2
Additional Troponin I type 2 (fast skeletal) Products
Product Documents for Troponin I type 2 (fast skeletal) Antibody (2H7S10)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Troponin I type 2 (fast skeletal) Antibody (2H7S10)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Troponin I type 2 (fast skeletal) Antibody (2H7S10)
There are currently no reviews for this product. Be the first to review Troponin I type 2 (fast skeletal) Antibody (2H7S10) and earn rewards!
Have you used Troponin I type 2 (fast skeletal) Antibody (2H7S10)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...