Troponin I type 2 (fast skeletal) Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38775

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Troponin I type 2 (fast skeletal) Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Troponin I type 2 (fast skeletal) Antibody - BSA Free

Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining in human skeletal muscle and heart muscle tissues using anti-TNNI2 antibody. Corresponding TNNI2 RNA-seq data are presented for the same tissues.
Western Blot: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Western Blot: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Western Blot: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Immunocytochemistry/ Immunofluorescence: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Immunocytochemistry/Immunofluorescence: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human cell line hTCEpi shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human heart muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775]

Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human skeletal muscle shows high expression.

Applications for Troponin I type 2 (fast skeletal) Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Troponin I type 2 (fast skeletal)

The troponin I type 2 gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible

Alternate Names

skeletal, fast, troponin I type 2 (skeletal, fast), troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, troponin I, fast-twitch skeletal muscle isoform

Gene Symbol

TNNI2

UniProt

P48788 (Human)

Additional Troponin I type 2 (fast skeletal) Products

Product Documents for Troponin I type 2 (fast skeletal) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Troponin I type 2 (fast skeletal) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Troponin I type 2 (fast skeletal) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Troponin I type 2 (fast skeletal) Antibody - BSA Free and earn rewards!

Have you used Troponin I type 2 (fast skeletal) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies