TUSC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82537

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TUSC4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Scientific Data Images for TUSC4 Antibody - BSA Free

Western Blot: TUSC4 Antibody [NBP1-82537]

Western Blot: TUSC4 Antibody [NBP1-82537]

Western Blot: TUSC4 Antibody [NBP1-82537] - Analysis in control (vector only transfected HEK293T lysate) and NPRL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: TUSC4 Antibody [NBP1-82537]

Immunocytochemistry/ Immunofluorescence: TUSC4 Antibody [NBP1-82537]

Immunocytochemistry/Immunofluorescence: TUSC4 Antibody [NBP1-82537] - Staining of human cell line PC-3 shows localization to cytosol & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TUSC4 Antibody [NBP1-82537]

Immunohistochemistry-Paraffin: TUSC4 Antibody [NBP1-82537]

Immunohistochemistry-Paraffin: TUSC4 Antibody [NBP1-82537] - Staining of human pancreas shows strong cytoplasmic and/or nuclear positivity in exocrine glandular cells.

Applications for TUSC4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TUSC4

Suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. Down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. May act as a tumor suppressor. Suppresses cell growth and enhanced sensitivity to various anticancer drugs

Alternate Names

G21 protein, Gene 21 protein, homologous to yeast nitrogen permease (candidate tumor suppressor), nitrogen permease regulator 2-like protein, nitrogen permease regulator-like 2 (S. cerevisiae), NPR2, NPR2L2810446G01Rik, NPRL2, Tumor suppressor candidate 4NPR2-like protein, TUSC4

Gene Symbol

NPRL2

UniProt

Q8WTW4 (Human)

Additional TUSC4 Products

Product Documents for TUSC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TUSC4 Antibody - BSA Free

The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TUSC4 Antibody - BSA Free

Customer Reviews for TUSC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TUSC4 Antibody - BSA Free and earn rewards!

Have you used TUSC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies