TXNDC Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35485

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human TXNDC (NP_110382.3).

Sequence:
KRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TXNDC Antibody - BSA Free

TXNDC Antibody

Immunohistochemistry: TXNDC Antibody [NBP3-35485] -

Immunohistochemistry: TXNDC Antibody [NBP3-35485] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using TXNDC Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
TXNDC Antibody

Immunohistochemistry: TXNDC Antibody [NBP3-35485] -

Immunohistochemistry: TXNDC Antibody [NBP3-35485] - Immunohistochemistry analysis of paraffin-embedded Rat brain using TXNDC Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
TXNDC Antibody

Immunohistochemistry: TXNDC Antibody [NBP3-35485] -

Immunohistochemistry: TXNDC Antibody [NBP3-35485] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using TXNDC Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
TXNDC Antibody

Immunohistochemistry: TXNDC Antibody [NBP3-35485] -

Immunohistochemistry: TXNDC Antibody [NBP3-35485] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using TXNDC Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
TXNDC Antibody

Western Blot: TXNDC Antibody [NBP3-35485] -

Western Blot: TXNDC Antibody [NBP3-35485] - Western blot analysis of various lysates using TXNDC Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for TXNDC Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TXNDC

TXNDC may participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions.

Alternate Names

DKFZp564E1962, PDIA11, protein disulfide isomerase family A, member 11, thioredoxin domain containing 1, thioredoxin domain-containing, Thioredoxin domain-containing protein 1, thioredoxin-related transmembrane protein 1, TMXTXNDC, Transmembrane Trx-related protein, TXNDC1thioredoxin domain containing

Gene Symbol

TMX1

Additional TXNDC Products

Product Documents for TXNDC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TXNDC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TXNDC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TXNDC Antibody - BSA Free and earn rewards!

Have you used TXNDC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...