UbcH10/UBE2C Antibody (5G5L9)

Novus Biologicals | Catalog # NBP3-16588

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5G5L9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human UbcH10/UBE2C (O00762). AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UbcH10/UBE2C Antibody (5G5L9)

Western Blot: UbcH10/UBE2C Antibody (5G5L9) [NBP3-16588]

Western Blot: UbcH10/UBE2C Antibody (5G5L9) [NBP3-16588]

Western Blot: UbcH10/UBE2C Antibody (5G5L9) [NBP3-16588] - Western blot analysis of extracts of various cell lines, using UbcH10/UBE2C Rabbit mAb (NBP3-16588) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: UbcH10/UBE2C Antibody (5G5L9) [NBP3-16588]

Immunocytochemistry/ Immunofluorescence: UbcH10/UBE2C Antibody (5G5L9) [NBP3-16588]

Immunocytochemistry/Immunofluorescence: UbcH10/UBE2C Antibody (5G5L9) [NBP3-16588] - Immunofluorescence analysis of U-2 OS cells using UbcH10/UBE2C Rabbit mAb (NBP3-16588) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for UbcH10/UBE2C Antibody (5G5L9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UbcH10/UBE2C

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Alternate Names

UBE2C

Gene Symbol

UBE2C

Additional UbcH10/UBE2C Products

Product Documents for UbcH10/UBE2C Antibody (5G5L9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UbcH10/UBE2C Antibody (5G5L9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UbcH10/UBE2C Antibody (5G5L9)

There are currently no reviews for this product. Be the first to review UbcH10/UBE2C Antibody (5G5L9) and earn rewards!

Have you used UbcH10/UBE2C Antibody (5G5L9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway
Ubiquitination Cascade Pathway Thumbnail