UBE2I/Ubc9 Antibody (6Z9V6)

Novus Biologicals | Catalog # NBP3-16400

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6Z9V6 expressed in HEK293
View all UBE2I/Ubc9 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2I/Ubc9 (P63279). MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEED

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UBE2I/Ubc9 Antibody (6Z9V6)

Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400]

Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400]

Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Western blot analysis of extracts of various cell lines, using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400]

Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400]

Western Blot: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Western blot analysis of extracts of HeLa cells, using UBE2I/Ubc9 Rabbit mAb (NBP3-16400) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
UBE2I/Ubc9 Antibody (6Z9V6)

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] -

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry analysis of UBE2I/Ubc9 in paraffin-embedded human thyroid cancer tissue using UBE2I/Ubc9 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UBE2I/Ubc9 Antibody (6Z9V6)

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] -

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry analysis of UBE2I/Ubc9 in paraffin-embedded rat colon tissue using UBE2I/Ubc9 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UBE2I/Ubc9 Antibody (6Z9V6)

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] -

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry analysis of UBE2I/Ubc9 in paraffin-embedded mouse testis tissue using UBE2I/Ubc9 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UBE2I/Ubc9 Antibody (6Z9V6)

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] -

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry analysis of UBE2I/Ubc9 in paraffin-embedded rat brain tissue using UBE2I/Ubc9 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UBE2I/Ubc9 Antibody (6Z9V6)

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] -

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry analysis of UBE2I/Ubc9 in paraffin-embedded mouse brain tissue using UBE2I/Ubc9 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UBE2I/Ubc9 Antibody (6Z9V6)

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] -

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry analysis of UBE2I/Ubc9 in paraffin-embedded mouse lung tissue using UBE2I/Ubc9 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
UBE2I/Ubc9 Antibody (6Z9V6)

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] -

Immunohistochemistry: UBE2I/Ubc9 Antibody (6Z9V6) [NBP3-16400] - Immunohistochemistry analysis of UBE2I/Ubc9 in paraffin-embedded mouse spleen tissue using UBE2I/Ubc9 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for UBE2I/Ubc9 Antibody (6Z9V6)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UBE2I/Ubc9

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene. Catalyzes the covalent attachment of ubiquitin-like protein SUMO-1 to other proteins. Forms a tight complex in association with two RAN GTPase interacting proteins, RANGAP1 and RANBP2. Interacts with E1A and E2A. Interacts with HIPK1 and HIPK2. Interacts with SIAH1 and PARP. Expressed in heart, skeletal muscle, pancreas, kidney, liver, lung, placenta and brain. Also expressed in testis and thymus.

Long Name

Ubiquitin-conjugating Enzyme E2I

Alternate Names

p18, SUMO-protein Ligase, Ubc9, UBCE9

Gene Symbol

UBE2I

Additional UBE2I/Ubc9 Products

Product Documents for UBE2I/Ubc9 Antibody (6Z9V6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UBE2I/Ubc9 Antibody (6Z9V6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBE2I/Ubc9 Antibody (6Z9V6)

There are currently no reviews for this product. Be the first to review UBE2I/Ubc9 Antibody (6Z9V6) and earn rewards!

Have you used UBE2I/Ubc9 Antibody (6Z9V6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies