UBE2N/Ubc13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55027

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to UBE2N (ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2N. Peptide sequence VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UBE2N/Ubc13 Antibody - BSA Free

Western Blot: UBE2N/Ubc13 Antibody [NBP1-55027]

Western Blot: UBE2N/Ubc13 Antibody [NBP1-55027]

Western Blot: UBE2N/Ubc13 Antibody [NBP1-55027] - Lanes: 1 : 40 ng HIS-UBE2D1 protein2: 40 ng HIS-UBE2D2 protein3: 40 ng HIS-UBE2D3 protein4: 40 ng HIS-UBE2D4 protein5: 40 ng HIS-UBE2E1 protein6: 40 ng HIS-UBE2E2 protein7: 40 ng HIS-UBE2E3 protein8: 40 ng HIS-UBE2K protein9: 40 ng HIS-UBE2L3 protein10: 40 ng HIS-UBE2N protein11 : 40 ng HIS-UBE2V1 protein12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 50,000 Gene name: UBE2N Submitted by: Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.
Western Blot: UBE2N/Ubc13 Antibody [NBP1-55027]

Western Blot: UBE2N/Ubc13 Antibody [NBP1-55027]

Western Blot: UBE2N/Ubc13 Antibody [NBP1-55027] - HepG2 cell lysate, concentration 1.25ug/ml.

Applications for UBE2N/Ubc13 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBE2N/Ubc13

UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Alternate Names

BLU, UBC13, UbcH13, UBE2N

Gene Symbol

UBE2N

UniProt

Additional UBE2N/Ubc13 Products

Product Documents for UBE2N/Ubc13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBE2N/Ubc13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for UBE2N/Ubc13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBE2N/Ubc13 Antibody - BSA Free and earn rewards!

Have you used UBE2N/Ubc13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway Ubiquitination Cascade Pathway Thumbnail