Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

Novus Biologicals | Catalog # NBP3-16792

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6H2I9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 959-1058 of human Ubiquitin-activating Enzyme/UBE1 (P22314). EVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

Western Blot: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Western Blot: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Western Blot: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792] - Western blot analysis of extracts of various cell lines, using Ubiquitin-activating Enzyme/UBE1 Rabbit mAb (NBP3-16792) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Immunocytochemistry/ Immunofluorescence: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Immunocytochemistry/Immunofluorescence: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792] - Immunofluorescence analysis of U-2 OS cells using Ubiquitin-activating Enzyme/UBE1 Rabbit mAb (NBP3-16792) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Immunohistochemistry-Paraffin: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Immunohistochemistry-Paraffin: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792] - Immunohistochemistry of paraffin-embedded human esophageal using Ubiquitin-activating Enzyme/UBE1 Rabbit mAb (NBP3-16792) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

Immunocytochemistry/ Immunofluorescence: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792] -

Immunocytochemistry/ Immunofluorescence: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792] - Confocal imaging of paraffin-embedded Human colon cancer tissue using Ubiquitin-activating Enzyme/UBE1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Applications for Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Ubiquitin-activating Enzyme/UBE1

E1 Ubiquitin Activating Enzyme is encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described.

Alternate Names

A1S9T, AMCX1, GXP1, POC20, SMAX2, UBA1, UBE1, Ubiquitinactivating Enzyme

Gene Symbol

UBA1

Additional Ubiquitin-activating Enzyme/UBE1 Products

Product Documents for Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

There are currently no reviews for this product. Be the first to review Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) and earn rewards!

Have you used Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway
Ubiquitination Cascade Pathway Thumbnail