UDP glucose dehydrogenase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90906

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UDP glucose dehydrogenase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AVVICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UDP glucose dehydrogenase Antibody - BSA Free

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human cerebral cortex, liver, prostate and rectum using Anti-UDP glucose dehydrogenase antibody NBP1-90906 (A) shows similar protein distribution across tissues to independent antibody NBP1-90997 (B).
Western Blot: UDP glucose dehydrogenase Antibody [NBP1-90906]

Western Blot: UDP glucose dehydrogenase Antibody [NBP1-90906]

Western Blot: UDP glucose dehydrogenase Antibody [NBP1-90906] - Analysis in human cell lines A-549 and HEK293 using anti-UGDH antibody. Corresponding UGDH RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Western Blot: UDP glucose dehydrogenase Antibody [NBP1-90906]

Western Blot: UDP glucose dehydrogenase Antibody [NBP1-90906]

Western Blot: UDP glucose dehydrogenase Antibody [NBP1-90906] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906]

Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
UDP glucose dehydrogenase Antibody - BSA Free Immunohistochemistry: UDP glucose dehydrogenase Antibody - BSA Free [NBP1-90906]

Immunohistochemistry: UDP glucose dehydrogenase Antibody - BSA Free [NBP1-90906]

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
UDP glucose dehydrogenase Antibody - BSA Free Immunohistochemistry: UDP glucose dehydrogenase Antibody - BSA Free [NBP1-90906]

Immunohistochemistry: UDP glucose dehydrogenase Antibody - BSA Free [NBP1-90906]

Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
UDP glucose dehydrogenase Antibody - BSA Free Western Blot: UDP glucose dehydrogenase Antibody - BSA Free [NBP1-90906]

Western Blot: UDP glucose dehydrogenase Antibody - BSA Free [NBP1-90906]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
UDP glucose dehydrogenase Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: UDP glucose dehydrogenase Antibody - BSA Free [NBP1-90906]

Immunocytochemistry/ Immunofluorescence: UDP glucose dehydrogenase Antibody - BSA Free [NBP1-90906]

Staining of human cell line U-2 OS shows localization to nucleoplasm.

Applications for UDP glucose dehydrogenase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UDP glucose dehydrogenase

UDP glucose dehydrogenase is encoded by this gene converts UDP-glucose to UDP-glucuronate and thereby participates in the biosynthesis of glycosaminoglycans such as hyaluronan, chondroitin sulfate, and heparan sulfate. These glycosylated compounds are common components of the extracellular matrix and likely play roles in signal transduction, cell migration, and cancer growth and metastasis. The expression of this gene is up-regulated by transforming growth factor beta and down-regulated by hypoxia. [provided by RefSeq]

Alternate Names

EC 1.1.1.22, GDH, UDPGDHUDP-glucose dehydrogenase, UDP-Glc dehydrogenase, UDP-GlcDH, UDP-glucose 6-dehydrogenase, UGD, uridine diphospho-glucose dehydrogenase

Gene Symbol

UGDH

Additional UDP glucose dehydrogenase Products

Product Documents for UDP glucose dehydrogenase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UDP glucose dehydrogenase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for UDP glucose dehydrogenase Antibody - BSA Free

Customer Reviews for UDP glucose dehydrogenase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UDP glucose dehydrogenase Antibody - BSA Free and earn rewards!

Have you used UDP glucose dehydrogenase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies