UFM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94235

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UFM1 (NP_057701.1). MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UFM1 Antibody - BSA Free

Western Blot: UFM1 AntibodyAzide and BSA Free [NBP2-94235]

Western Blot: UFM1 AntibodyAzide and BSA Free [NBP2-94235]

Western Blot: UFM1 Antibody [NBP2-94235] - Western blot analysis of extracts of various cell lines, using UFM1 antibody (NBP2-94235) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: UFM1 Antibody - Azide and BSA Free [NBP2-94235]

Immunohistochemistry-Paraffin: UFM1 Antibody - Azide and BSA Free [NBP2-94235]

Immunohistochemistry-Paraffin: UFM1 Antibody [NBP2-94235] - Immunohistochemistry of paraffin-embedded mouse brain using UFM1 Rabbit pAb (NBP2-94235) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
UFM1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: UFM1 Antibody - Azide and BSA Free [UFM1] -

Immunocytochemistry/ Immunofluorescence: UFM1 Antibody - Azide and BSA Free [UFM1] - Immunofluorescence analysis of NIH/3T3 cells using UFM1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
UFM1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: UFM1 Antibody - Azide and BSA Free [UFM1] -

Immunocytochemistry/ Immunofluorescence: UFM1 Antibody - Azide and BSA Free [UFM1] - Immunofluorescence analysis of U2OS cells using UFM1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for UFM1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:100 - 1:500

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UFM1

UFM1 is a ubiquitin-like protein that is conjugated to target proteins by E1-like activating enzyme UBA5 (UBE1DC1; MIM 610552) and E2-like conjugating enzyme UFC1 (MIM 610554) in a manner analogous to ubiquitinylation (see UBE2M; MIM 603173) (Komatsu et al., 2004 [PubMed 15071506]).[supplied by OMIM]

Long Name

Ubiquitin-fold Modifier 1

Alternate Names

C13orf20

Gene Symbol

UFM1

Additional UFM1 Products

Product Documents for UFM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UFM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UFM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UFM1 Antibody - BSA Free and earn rewards!

Have you used UFM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...