UGP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85918

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UGP2 Antibody - BSA Free

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918] - Staining of human kidney, liver, rectum and skeletal muscle using Anti-UGP2 antibody NBP1-85918 (A) shows similar protein distribution across tissues to independent antibody NBP2-49427 (B).
Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918] - Staining of human rectum.
Western Blot: UGP2 Antibody [NBP1-85918]

Western Blot: UGP2 Antibody [NBP1-85918]

Western Blot: UGP2 Antibody [NBP1-85918] - Analysis using Anti-UGP2 antibody NBP1-85918 (A) shows similar pattern to independent antibody NBP2-48625 (B).
Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918] - Staining of human kidney.
Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918] - Staining of human liver.
Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918]

Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918] - Staining of human skeletal muscle.
UGP2 Antibody - BSA Free Western Blot: UGP2 Antibody - BSA Free [NBP1-85918]

Western Blot: UGP2 Antibody - BSA Free [NBP1-85918]

Lane 1: Mouse liver tissue lysate
Lane 2: Rat liver tissue lysate

Applications for UGP2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UGP2

The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

EC 2.7.7.9, pHC379, UDPG, UDP-glucose diphosphorylase, UDP-glucose pyrophosphorylase, UDP-glucose pyrophosphorylase 2, UDPGP, UDPGP2, UGP1, UGPase, UGPase 2, UGPP2, uridyl diphosphate glucose pyrophosphorylase 2, UTP-glucose-1-phosphate uridyltransferase, UTP--glucose-1-phosphate uridylyltransferase, UTP--glucose-1-phosphate uridylyltransferase 2

Gene Symbol

UGP2

Additional UGP2 Products

Product Documents for UGP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UGP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UGP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UGP2 Antibody - BSA Free and earn rewards!

Have you used UGP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...