UQCRFS1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87826
![Western Blot: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Western-Blot-NBP1-87826-img0025.jpg "Western Blot: UQCRFS1 Antibody [NBP1-87826]")
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human, Rat
Cited:
Human
Predicted:
Mouse (94%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
Reactivity Notes
Human reactivity reported in scientific literature (PMID: 25605331).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for UQCRFS1 Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87826-img0023.jpg "Immunocytochemistry/ Immunofluorescence: UQCRFS1 Antibody [NBP1-87826]")
Immunocytochemistry/ Immunofluorescence: UQCRFS1 Antibody [NBP1-87826]
Immunocytochemistry/Immunofluorescence: UQCRFS1 Antibody [NBP1-87826] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0029.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis using Anti-UQCRFS1 antibody NBP1-87826.![Western Blot: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Western-Blot-NBP1-87826-img0010.jpg "Western Blot: UQCRFS1 Antibody [NBP1-87826]")
Western Blot: UQCRFS1 Antibody [NBP1-87826]
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in human cell line A-549.![Western Blot: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Western-Blot-NBP1-87826-img0011.jpg "Western Blot: UQCRFS1 Antibody [NBP1-87826]")
Western Blot: UQCRFS1 Antibody [NBP1-87826]
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0018.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in myocytes.![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0019.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0020.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0021.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0022.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0024.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon, kidney, liver and testis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar protein distribution across tissues to independent antibody NBP2-38623 (B).![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0026.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human liver.![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0027.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon.![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0028.jpg "Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]")
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826]
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney using Anti-UQCRFS1 antibody NBP1-87826.![Simple Western: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Simple-Western-NBP1-87826-img0007.jpg "Simple Western: UQCRFS1 Antibody [NBP1-87826]")
Simple Western: UQCRFS1 Antibody [NBP1-87826]
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Simple Western lane view shows a specific band for RIP1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.![Simple Western: UQCRFS1 Antibody [NBP1-87826]](https://resources.rndsystems.com/images/products/UQCRFS1-Antibody-Simple-Western-NBP1-87826-img0009.jpg "Simple Western: UQCRFS1 Antibody [NBP1-87826]")
Simple Western: UQCRFS1 Antibody [NBP1-87826]
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Electropherogram image(s) of corresponding Simple Western lane view. UQCRFS1 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).Applications for UQCRFS1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Simple Western
1:30
Western Blot
0.04-0.4 ug/ml
Application Notes
WB reported in the literature (PMID:25605331). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 31 kDa
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 31 kDa
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: UQCRFS1
Alternate Names
Complex III subunit 5, Cytochrome b-c1 complex subunit 5, cytochrome b-c1 complex subunit Rieske, mitochondrial, EC 1.10.2.2, Rieske iron-sulfur protein, RIP1, RIS1, RISPUbiquinol-cytochrome c reductase iron-sulfur subunit, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1, UQCR5
Gene Symbol
UQCRFS1
Additional UQCRFS1 Products
Product Documents for UQCRFS1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for UQCRFS1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for UQCRFS1 Antibody - BSA Free
Powered by Bioz
Customer Reviews for UQCRFS1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review UQCRFS1 Antibody - BSA Free and earn rewards!
Have you used UQCRFS1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...