UTP18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13511

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UTP18 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Human reactivity reported in scientific literature (PMID: 25435373).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UTP18 Antibody - BSA Free

Western Blot: UTP18 Antibody [NBP2-13511]

Western Blot: UTP18 Antibody [NBP2-13511]

Western Blot: UTP18 Antibody [NBP2-13511] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: UTP18 Antibody [NBP2-13511]

Immunocytochemistry/ Immunofluorescence: UTP18 Antibody [NBP2-13511]

Immunocytochemistry/Immunofluorescence: UTP18 Antibody [NBP2-13511] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: UTP18 Antibody [NBP2-13511]

Immunohistochemistry-Paraffin: UTP18 Antibody [NBP2-13511]

Immunohistochemistry-Paraffin: UTP18 Antibody [NBP2-13511] - Staining of human cerebral cortex shows strong nucleolar positivity in neurons.
Immunocytochemistry/ Immunofluorescence: UTP18 Antibody [NBP2-13511]

Immunocytochemistry/ Immunofluorescence: UTP18 Antibody [NBP2-13511]

Immunocytochemistry/Immunofluorescence: UTP18 Antibody [NBP2-13511] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.

Applications for UTP18 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UTP18

UTP18/WDR50 is a component of the small-subunit (SSU) processome, a large ribonucleoprotein complex that participates in ribosomal RNA processing and ribosome assembly. UTP18/WDR50 is a member of the WD repeat family. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation.

Alternate Names

CGI-48, U3 small nucleolar RNA-associated protein 18 homolog, UTP18, small subunit (SSU) processome component, homolog (yeast), WD repeat domain 50, WD repeat-containing protein 50, WDR50

Gene Symbol

UTP18

Additional UTP18 Products

Product Documents for UTP18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UTP18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for UTP18 Antibody - BSA Free

Customer Reviews for UTP18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UTP18 Antibody - BSA Free and earn rewards!

Have you used UTP18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies