VAChT/SLC18A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35635

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 473-532 of human VAChT/SLC18A3 (NP_003046.2).

Sequence:
GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for VAChT/SLC18A3 Antibody - BSA Free

VAChT/SLC18A3 Antibody

Immunocytochemistry/ Immunofluorescence: VAChT/SLC18A3 Antibody [NBP3-35635] -

Immunocytochemistry/ Immunofluorescence: VAChT/SLC18A3 Antibody [NBP3-35635] - Immunofluorescence analysis of paraffin-embedded mouse brain using VAChT/SLC18A3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
VAChT/SLC18A3 Antibody

Immunohistochemistry: VAChT/SLC18A3 Antibody [NBP3-35635] -

Immunohistochemistry: VAChT/SLC18A3 Antibody [NBP3-35635] - Immunohistochemistry analysis of paraffin-embedded Rat brain using VAChT/SLC18A3 Rabbit pAb at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for VAChT/SLC18A3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VAChT/SLC18A3

Vesicular Acetylcholine Transporter (VAChT), (approx. 70kD protein), belongs to the family of vesicular monoamine transporters(VMATs), which include VMAT1 and VMAT2 and the C.elegans putative ACh transporter unc-17. Members of this family function to concentrate neurotransmitters into synaptic vesicles through exchange of protons for neurotransmitters. VAChT is a functional transporter for the neurotransmitter acetylcholine(ACh). ACh is synthesized in the cytoplasm by choline acetyl transferase (ChAT) and transported by VAChT into synaptic vesicles where it is stored until released. After release from presynaptic nerve terminals ACh is hydrolyzed by extracellular ACh-esterases(AChE) to choline and acetate. VAChT mRNA is expressed in all known major cholinergic neurons in the central and peripheral nervous system. VAChT is abundantly expressed in the CNS and is mainly localized in small synaptic vesicles in cholinergic nerve terminals. VAChT provides a specific marker for cholinergic neurons for the study of cholinergic transmission in experimental models, in Alzheimer's disease and other nervous system disorders.

Long Name

Vesicular Acetylcholine Transporter/Solute Carrier Family 18 Member 3

Alternate Names

SLC18A3

Gene Symbol

SLC18A3

Additional VAChT/SLC18A3 Products

Product Documents for VAChT/SLC18A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VAChT/SLC18A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VAChT/SLC18A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VAChT/SLC18A3 Antibody - BSA Free and earn rewards!

Have you used VAChT/SLC18A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...