VAMP-1 Antibody (1A3K6)

Novus Biologicals | Catalog # NBP3-16212

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1A3K6 expressed in HEK293
View all VAMP-1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human VAMP-1 (P23763). MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VAMP-1 Antibody (1A3K6)

Western Blot: VAMP-1 Antibody (1A3K6) [NBP3-16212]

Western Blot: VAMP-1 Antibody (1A3K6) [NBP3-16212]

Western Blot: VAMP-1 Antibody (1A3K6) [NBP3-16212] - Western blot analysis of extracts of various cell lines, using VAMP-1 Rabbit mAb (NBP3-16212) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
VAMP-1 Antibody (1A3K6)

Immunocytochemistry/ Immunofluorescence: VAMP-1 Antibody (1A3K6) [NBP3-16212] -

Immunocytochemistry/ Immunofluorescence: VAMP-1 Antibody (1A3K6) [NBP3-16212] - Immunofluorescence analysis of U-2 OS cells using VAMP-1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
VAMP-1 Antibody (1A3K6)

Immunohistochemistry: VAMP-1 Antibody (1A3K6) [NBP3-16212] -

Immunohistochemistry: VAMP-1 Antibody (1A3K6) [NBP3-16212] - Immunohistochemistry analysis of VAMP-1 in paraffin-embedded mouse brain tissue using VAMP-1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
VAMP-1 Antibody (1A3K6)

Immunohistochemistry: VAMP-1 Antibody (1A3K6) [NBP3-16212] -

Immunohistochemistry: VAMP-1 Antibody (1A3K6) [NBP3-16212] - Immunohistochemistry analysis of VAMP-1 in paraffin-embedded mouse colon tissue using VAMP-1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
VAMP-1 Antibody (1A3K6)

Immunohistochemistry: VAMP-1 Antibody (1A3K6) [NBP3-16212] -

Immunohistochemistry: VAMP-1 Antibody (1A3K6) [NBP3-16212] - Immunohistochemistry analysis of VAMP-1 in paraffin-embedded rat brain tissue using VAMP-1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
VAMP-1 Antibody (1A3K6)

Immunohistochemistry: VAMP-1 Antibody (1A3K6) [NBP3-16212] -

Immunohistochemistry: VAMP-1 Antibody (1A3K6) [NBP3-16212] - Immunohistochemistry analysis of VAMP-1 in paraffin-embedded human brain tissue using VAMP-1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
VAMP-1 Antibody (1A3K6)

Immunocytochemistry/ Immunofluorescence: VAMP-1 Antibody (1A3K6) [NBP3-16212] -

Immunocytochemistry/ Immunofluorescence: VAMP-1 Antibody (1A3K6) [NBP3-16212] - Immunofluorescence analysis of C6 cells using VAMP-1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
VAMP-1 Antibody (1A3K6)

Immunocytochemistry/ Immunofluorescence: VAMP-1 Antibody (1A3K6) [NBP3-16212] -

Immunocytochemistry/ Immunofluorescence: VAMP-1 Antibody (1A3K6) [NBP3-16212] - Immunofluorescence analysis of NIH-3T3 cells using VAMP-1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for VAMP-1 Antibody (1A3K6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VAMP-1

The Vesicle Associated Membrane Proteins (VAMP) or synaptobrevins are calcium binding proteins specific to eukaryotes. VAMPs, along with synaptosomal associated protein of 25 kDa (SNAP-25) and syntaxin, form the core complex of soluble NSF attachment protein receptor (SNARE) proteins that interact with the soluble proteins N-ethylmaleimide-sensitive factor (NSF) and alpha-SNAP. These membrane associated proteins play a key role in the regulation of vesicle membrane fusion with the plasma membrane. The Clostridium tetani neurotoxin is a metalloprotease with specificity for VAMP. In Alzheimer®s disease, VAMP levels of all isoforms appear to be significantly lowered. It has been shown that the extreme carboxy-terminus of VAMP-1 is involved in subcellular vesicle targeting.

Long Name

Vesicle-Associated Membrane Protein 1

Alternate Names

SYB1, Synaptobrevin-1, VAMP1

Gene Symbol

VAMP1

Additional VAMP-1 Products

Product Documents for VAMP-1 Antibody (1A3K6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VAMP-1 Antibody (1A3K6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VAMP-1 Antibody (1A3K6)

There are currently no reviews for this product. Be the first to review VAMP-1 Antibody (1A3K6) and earn rewards!

Have you used VAMP-1 Antibody (1A3K6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies