VAMP-7 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15595

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 11-70 of human VAMP-7 (P51809). GTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VAMP-7 Antibody - Azide and BSA Free

VAMP-7 Antibody - Azide and BSA Free

Western Blot: VAMP-7 Antibody [NBP3-15595] -

Western Blot: VAMP-7 Antibody [NBP3-15595] - analysis of various lysates, using VAMP7 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.
VAMP-7 Antibody - Azide and BSA Free

Western Blot: VAMP-7 Antibody [NBP3-15595] -

Western Blot: VAMP-7 Antibody [NBP3-15595] -analysis of Mouse brain, using VAMP7 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: VAMP-7 Antibody - Azide and BSA Free [NBP3-15595]

Immunocytochemistry/ Immunofluorescence: VAMP-7 Antibody - Azide and BSA Free [NBP3-15595]

Immunocytochemistry/Immunofluorescence: VAMP-7 Antibody [NBP3-15595] - Immunofluorescence analysis of C6 cells using VAMP-7 antibody (NBP3-15595) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: VAMP-7 Antibody - Azide and BSA Free [NBP3-15595]

Immunocytochemistry/ Immunofluorescence: VAMP-7 Antibody - Azide and BSA Free [NBP3-15595]

Immunocytochemistry/Immunofluorescence: VAMP-7 Antibody [NBP3-15595] - Immunofluorescence analysis of U2OS cells using VAMP-7 antibody (NBP3-15595) at dilution of 1:100. Blue: DAPI for nuclear staining.
VAMP-7 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: VAMP-7 Antibody - Azide and BSA Free [VAMP-7] -

Immunocytochemistry/ Immunofluorescence: VAMP-7 Antibody - Azide and BSA Free [VAMP-7] - Immunofluorescence analysis of NIH/3T3 cells using VAMP-7 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for VAMP-7 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VAMP-7

Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.

Long Name

Vesicle-Associated Membrane Protein 7

Alternate Names

SYBL1, TI-VAMP, VAMP7

Gene Symbol

VAMP7

Additional VAMP-7 Products

Product Documents for VAMP-7 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VAMP-7 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

Customer Reviews for VAMP-7 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review VAMP-7 Antibody - Azide and BSA Free and earn rewards!

Have you used VAMP-7 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...