VDP p115 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35638

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 663-962 of human VDP p115 (NP_003706.2).

Sequence:
DLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

108 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for VDP p115 Antibody - BSA Free

VDP p115 Antibody

Immunocytochemistry/ Immunofluorescence: VDP p115 Antibody [NBP3-35638] -

Immunocytochemistry/ Immunofluorescence: VDP p115 Antibody [NBP3-35638] - Confocal immunofluorescence analysis of Hela cells using VDP p115 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.
VDP p115 Antibody

Immunocytochemistry/ Immunofluorescence: VDP p115 Antibody [NBP3-35638] -

Immunocytochemistry/ Immunofluorescence: VDP p115 Antibody [NBP3-35638] - Confocal immunofluorescence analysis of HeLa cells using VDP p115 Rabbit pAb at dilution of 1:50. Blue: DAPI for nuclear staining.
VDP p115 Antibody

Western Blot: VDP p115 Antibody [NBP3-35638] -

Western Blot: VDP p115 Antibody [NBP3-35638] - Western blot analysis of various lysates using VDP p115 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
VDP p115 Antibody

Immunocytochemistry/ Immunofluorescence: VDP p115 Antibody [NBP3-35638] -

Immunocytochemistry/ Immunofluorescence: VDP p115 Antibody [NBP3-35638] - Immunofluorescence analysis of HeLa cells using VDP p115 Rabbit pAb at dilution of 1:200 (60x lens). Blue: DAPI for nuclear staining.

Applications for VDP p115 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VDP p115

p115 (Vesicle docking protein p115) is a peripheral membrane protein that is located on the Golgi complex. p115 exists as a homodimer with two globular heads, an extended coiled-coil tail, followed by an acidic domain at the extreme C terminus. p115 is homologous to a yeast protein, Uso1p, which is required for ER to Golgi transport. p115 likely plays an important role in vesicle transportation from the ER to the cis-Golgi comparments.

Alternate Names

p115, Transcytosis-associated protein, USO1 homolog, vesicle docking protein (yeast), USO1 vesicle docking protein homolog (yeast), vesicle docking protein, vesicle docking protein p115

Gene Symbol

USO1

Additional VDP p115 Products

Product Documents for VDP p115 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VDP p115 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VDP p115 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VDP p115 Antibody - BSA Free and earn rewards!

Have you used VDP p115 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...