VPS16 Antibody (2F10) - Azide and BSA Free

Novus Biologicals | Catalog # H00064601-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2F10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

VPS16 (NP_072097.2, 754 a.a. ~ 839 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK

Specificity

VPS16 - vacuolar protein sorting 16 homolog (S. cerevisiae) (2F10)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for VPS16 Antibody (2F10) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: VPS16 Antibody (2F10) [H00064601-M05]

Immunocytochemistry/ Immunofluorescence: VPS16 Antibody (2F10) [H00064601-M05]

Immunocytochemistry/Immunofluorescence: VPS16 Antibody (2F10) [H00064601-M05] - Immunofluorescence of monoclonal antibody to VPS16 on HeLa cell. [antibody concentration 40 ug/ml]
Immunocytochemistry/ Immunofluorescence: VPS16 Antibody (2F10) [H00064601-M05]

Immunocytochemistry/ Immunofluorescence: VPS16 Antibody (2F10) [H00064601-M05]

Immunocytochemistry/Immunofluorescence: VPS16 Antibody (2F10) [H00064601-M05] - Analysis of monoclonal antibody to VPS16 on HeLa cell. Antibody concentration 40 ug/ml
Sandwich ELISA: VPS16 Antibody (2F10) [H00064601-M05] - Detection limit for recombinant GST tagged VPS16 is 3 ng/ml as a capture antibody.

Applications for VPS16 Antibody (2F10) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: VPS16

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps16 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq]

Alternate Names

hVPS16, vacuolar protein sorting 16 homolog (S. cerevisiae), vacuolar protein sorting protein 16, vacuolar protein sorting-associated protein 16 homolog

Entrez Gene IDs

64601 (Human)

Gene Symbol

VPS16

Additional VPS16 Products

Product Documents for VPS16 Antibody (2F10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VPS16 Antibody (2F10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VPS16 Antibody (2F10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review VPS16 Antibody (2F10) - Azide and BSA Free and earn rewards!

Have you used VPS16 Antibody (2F10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...