VPS37B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82283

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VPS37B Antibody - BSA Free

Western Blot: VPS37B Antibody [NBP1-82283]

Western Blot: VPS37B Antibody [NBP1-82283]

Western Blot: VPS37B Antibody [NBP1-82283] - Analysis using Anti-VPS37B antibody NBP1-82283 (A) shows similar pattern to independent antibody NBP2-38398 (B).
Western Blot: VPS37B Antibody [NBP1-82283]

Western Blot: VPS37B Antibody [NBP1-82283]

Western Blot: VPS37B Antibody [NBP1-82283] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
VPS37B Antibody - BSA Free Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
VPS37B Antibody - BSA Free Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
VPS37B Antibody - BSA Free Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Staining of human lymph node.
VPS37B Antibody - BSA Free Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Staining of human cerebral cortex.
VPS37B Antibody - BSA Free Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Staining of human colon shows strong cytoplasmic positivity in glandular cells.
VPS37B Antibody - BSA Free Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Staining of human fallopian tube shows strong positivity in apical membrane and moderate cytoplasmic staining in glandular cells.
VPS37B Antibody - BSA Free Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283]

Staining of human cerebral cortex, colon, lymph node and testis HPA038217 (A) shows similar protein distribution across tissues to independent antibody HPA038218 (B).

Applications for VPS37B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VPS37B

VPS37B is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting ofendocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation

Alternate Names

ESCRT-I complex subunit VPS37B, FLJ12750, hVps37B, vacuolar protein sorting 37 homolog B (S. cerevisiae), vacuolar protein sorting 37B, vacuolar protein sorting 37B (yeast), vacuolar protein sorting-associated protein 37B

Gene Symbol

VPS37B

Additional VPS37B Products

Product Documents for VPS37B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VPS37B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VPS37B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VPS37B Antibody - BSA Free and earn rewards!

Have you used VPS37B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...