VTA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86745

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VTA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745]

Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745]

Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745]

Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745]

Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745]

Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745]

Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human cerebral cortex shows weak positivity in neurons.
Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745]

Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745]

Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human skeletal muscle shows negative to very weak cytoplasmic positivity in myocytes.
Western Blot: VTA1 Antibody [NBP1-86745]

Western Blot: VTA1 Antibody [NBP1-86745]

Western Blot: VTA1 Antibody [NBP1-86745] - Analysis using Anti-VTA1 antibody NBP1-86745 (A) shows similar pattern to independent antibody NBP2-58305 (B).
VTA1 Antibody - BSA Free Western Blot: VTA1 Antibody - BSA Free [NBP1-86745]

Western Blot: VTA1 Antibody - BSA Free [NBP1-86745]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for VTA1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VTA1

C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 (PubMed 15644320)).(supplied by OMIM

Alternate Names

C6orf55DRG1, Dopamine-responsive gene 1 protein, DRG-1, FLJ27228, homolog of mouse SKD1-binding protein 1, LIP5HSPC228, LYST-interacting protein 5, My012, SBP1chromosome 6 open reading frame 55, SKD1-binding protein 1, vacuolar protein sorting-associated protein VTA1 homolog, Vps20-associated 1 homolog (S. cerevisiae)

Gene Symbol

VTA1

Additional VTA1 Products

Product Documents for VTA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VTA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VTA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VTA1 Antibody - BSA Free and earn rewards!

Have you used VTA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...