WIRE Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86858

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WIRE Antibody - BSA Free

Western Blot: WIRE Antibody [NBP1-86858]

Western Blot: WIRE Antibody [NBP1-86858]

Western Blot: WIRE Antibody [NBP1-86858] - Analysis using Anti-WIPF2 antibody NBP1-86858 (A) shows similar pattern to independent antibody NBP1-86857 (B).
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858] - Analysis in human cerebral cortex and liver tissues using NBP1-86858 antibody. Corresponding WIRE RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86858] - Staining of human cerebral cortex, colon, fallopian tube and liver using Anti-WIRE antibody NBP1-86858 (A) shows similar protein distribution across tissues to independent antibody NBP1-86857 (B).
WIRE Antibody - BSA Free Western Blot: WIRE Antibody - BSA Free [NBP1-86858]

Western Blot: WIRE Antibody - BSA Free [NBP1-86858]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
WIRE Antibody - BSA Free Immunohistochemistry-Paraffin: WIRE Antibody - BSA Free [NBP1-86858]

Immunohistochemistry-Paraffin: WIRE Antibody - BSA Free [NBP1-86858]

Staining of human cell line U-2 OS shows localization to nucleoplasm.

Applications for WIRE Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WIRE

Alternate Names

PP10631, WAS/WASL interacting protein family, member 2, WIP-related protein

Gene Symbol

WIPF2

Additional WIRE Products

Product Documents for WIRE Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WIRE Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WIRE Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WIRE Antibody - BSA Free and earn rewards!

Have you used WIRE Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...