WNK3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93100

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WNK3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human WNK3 (NP_065973.2). AGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WNK3 Antibody - BSA Free

Western Blot: WNK3 AntibodyAzide and BSA Free [NBP2-93100]

Western Blot: WNK3 AntibodyAzide and BSA Free [NBP2-93100]

Western Blot: WNK3 Antibody [NBP2-93100] - Analysis of HAP1, using WNK3 antibody at 1:540 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.
WNK3 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: WNK3 Antibody - Azide and BSA Free [NBP2-93100] -

Immunocytochemistry/ Immunofluorescence: WNK3 Antibody - Azide and BSA Free [NBP2-93100] - Immunofluorescence analysis of NIH/3T3 cells using WNK3 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
WNK3 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: WNK3 Antibody - Azide and BSA Free [NBP2-93100] -

Immunocytochemistry/ Immunofluorescence: WNK3 Antibody - Azide and BSA Free [NBP2-93100] - Immunofluorescence analysis of U2OS cells using WNK3 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
WNK3 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: WNK3 Antibody - Azide and BSA Free [NBP2-93100] -

Immunocytochemistry/ Immunofluorescence: WNK3 Antibody - Azide and BSA Free [NBP2-93100] - Immunofluorescence analysis of PC-12 cells using WNK3 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for WNK3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: WNK3

Members of the 'with no lysine' (WNK) kinase family, such as WNK3, are serine-threonine protein kinases thatlack the almost invariant catalytic lysine in subdomain II, which is important for binding ATP in the catalytic site.Instead, these kinases have a conserved lysine in subdomain I that is thought to provide this function (Holden et al.,2004 (PubMed 15194194)).(supplied by OMIM)

Alternate Names

EC 2.7.11, FLJ30437, KIAA1566FLJ42662, PRKWNK3lysine deficient 3, WNK lysine deficient protein kinase 3

Gene Symbol

WNK3

Additional WNK3 Products

Product Documents for WNK3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WNK3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WNK3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WNK3 Antibody - BSA Free and earn rewards!

Have you used WNK3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies