WTAP Antibody (1B11) - Azide and BSA Free

Novus Biologicals | Catalog # H00009589-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1B11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

WTAP (NP_690596.1, 70 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR

Specificity

WTAP - Wilms tumor 1 associated protein (1B11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for WTAP Antibody (1B11) - Azide and BSA Free

Immunohistochemistry-Paraffin: WTAP Antibody (1B11) [H00009589-M01]

Immunohistochemistry-Paraffin: WTAP Antibody (1B11) [H00009589-M01]

Immunohistochemistry-Paraffin: WTAP Antibody (1B11) [H00009589-M01] - Analysis of monoclonal antibody to WTAP on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Sandwich ELISA: WTAP Antibody (1B11) [H00009589-M01] - Detection limit for recombinant GST tagged WTAP is 0.1 ng/ml as a capture antibody.

Applications for WTAP Antibody (1B11) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: WTAP

The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in three transcript variants, two of which encode the same isoform. [provided by RefSeq]

Alternate Names

Female-lethal(2)D homolog, hFL(2)D, KIAA0105DKFZp686F20131, MGC3925, PNAS-132, pre-mRNA-splicing regulator WTAP, putative pre-mRNA splicing regulator female-lethal(2D), Wilms tumor 1 associated protein, Wilms tumor 1-associating protein, Wilms' tumour 1-associating protein, WT1-associated protein

Entrez Gene IDs

9589 (Human)

Gene Symbol

WTAP

Additional WTAP Products

Product Documents for WTAP Antibody (1B11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WTAP Antibody (1B11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WTAP Antibody (1B11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review WTAP Antibody (1B11) - Azide and BSA Free and earn rewards!

Have you used WTAP Antibody (1B11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...